Zingiber officinale (ginger): 122043834 Help Entry 122043834         CDS       T08725                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zof  Zingiber officinale (ginger) Pathway zof04145   Phagosome zof04148   Efferocytosis zof04620   Toll-like receptor signaling pathway zof05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zof00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122043834    04148 Efferocytosis     122043834  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122043834  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122043834  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122043834   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122043834    04031 GTP-binding proteins [BR:zof04031]     122043834 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122043834  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122043834   Macropinocytosis    Ras GTPases     122043834  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122043834 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122043834   Exosomal proteins of other body fluids (saliva and urine)    122043834   Exosomal proteins of colorectal cancer cells    122043834   Exosomal proteins of bladder cancer cells    122043834 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122043834 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  122043834 NCBI-ProteinID:  XP_042460342 LinkDB All DBs Position 2A:98671128..98672000 Genome browser AA seq 122 aa AA seqDB search MLTFLVYEHQWMPELRRFVPNVPIVLVGTKLDLRDDKAYLADHHGATTITPAQRERLRKQ TGAAAYIECTSKTQQNVKAVVDTAIKVVLQPPQTKESAKKKTKRSSGCLMANLMCGGGTC VS NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgttgacatttttggtttatgaacaccaatggatgccagaacttcgccggtttgtgcct aatgttcctatagttttggttggaacaaaattagatctccgtgatgacaaagcttatctt gctgatcatcatggtgcaacaacaataactccagcacaaagagaaaggctgaggaaacaa actggtgctgcagcatatattgaatgtacctccaaaacccaacagaacgtcaaagctgta gttgatactgcaatcaaggtggttcttcaacccccacaaacgaaggagtctgccaagaaa aaaaccaaaagaagctctggctgtctaatggcaaatctcatgtgtggaggcggcacatgc gtgagctag

DBGET integrated database retrieval system