Zingiber officinale (ginger): 122051843 Help Entry 122051843         CDS       T08725                                  Name (RefSeq) calmodulin-3-like   KO K02183   calmodulin Organism zof  Zingiber officinale (ginger) Pathway zof04016   MAPK signaling pathway - plant zof04070   Phosphatidylinositol signaling system zof04075   Plant hormone signal transduction zof04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:zof00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     122051843    04070 Phosphatidylinositol signaling system     122051843    04075 Plant hormone signal transduction     122051843  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     122051843  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:zof01009]     122051843   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122051843    03036 Chromosome and associated proteins [BR:zof03036]     122051843   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122051843 Protein phosphatases and associated proteins [BR:zof01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122051843 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122051843 Chromosome and associated proteins [BR:zof03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122051843 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122051843 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C Dockerin_1 UPF0154 DUF5580_M EF-hand_11 EFhand_Ca_insen Caleosin RNA_pol_Rpb4 FCaBP_EF-hand PA_Ig-like SPEF2_C MotA_activ SurA_N_2 Fe_hyd_lg_C YtzH MecA_N Motif Other DBs NCBI-GeneID:  122051843 NCBI-ProteinID:  XP_042469079 LinkDB All DBs Position 3A:46750699..46755411 Genome browser AA seq 149 aa AA seqDB search MMEQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMLNEVDADG NGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVVEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgatggagcaactcaccgacgagcagatcgcggagttcaaggaggctttcagcttgttc gacaaggatggcgatggctgcatcacaaccaaagagcttggaactgtcatgcgttcattg ggtcagaaccctacagaagctgaacttcaagacatgctaaatgaagttgatgccgatgga aatggtacaatcgactttgctgagtttcttaatttgatggctcgcaagatgaaggataca gattcagaggaggaactaaaggaggcattcagagtgtttgacaaggaccaaaatggcttc atctctgctgctgaacttcgtcatgtcatgaccaatctaggagagaagcttaccgatgag gaagtcgttgaaatgatacgcgaagctgatgttgatggcgatggccagatcaactatgat gaatttgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system