Zoogloeaceae bacteirum Par-f-2: C3497_05470 Help Entry C3497_05470       CDS       T05440                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism zpa  Zoogloeaceae bacteirum Par-f-2 Pathway zpa01100   Metabolic pathways zpa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:zpa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C3497_05470    00074 Mycolic acid biosynthesis     C3497_05470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C3497_05470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AVZ78945 UniProt:  A0A2S0QVK0 LinkDB All DBs Position 1159538..1159777 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKNESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVTAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaagaagatcgtcgctgagcaacttggcgtgaacgaa tcggagatcaagaacgagtcttcgttcgtggacgatctgggcgcggattcgctggacacc gtggaactggtcatggcgctggaagaagaattcgagtgcgagattccggacgaggaagcc gagaagatcaccactgttcagcaggcgatcgactacgtcactgctcatctgaagaagtaa

DBGET integrated database retrieval system