KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_07785
Entry
C3497_07785       CDS       T05440                                 

Name
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C3497_07785
Enzymes [BR:zpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     C3497_07785
SSDB
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Other DBs
NCBI-ProteinID: AVZ79348
UniProt: A0A2S0QU23
LinkDB
Position
1653117..1655000
AA seq 627 aa
MLRNPQKRIGPALRIAAVAIAVASAFTASATPVSWDDIANDANTTDDVLMYGMGLKGQRF
SPLTQINTQTVAGLVPAWSFSFGGEKQRGQEAQALVHDGVIYVTSSYSRIFALDARTGKQ
LWAYEHRLPDDIRPCCDVINRGAAIYGDKVFFGTLDASIVALDRQTGKVVWKKKFGDHKI
GYTMTGAPTIVKDQKSGRVLLVHGSSGDEFGVVGYLFARDPDTGEEVWARPLVEGHMGRL
NGKDSTPTGDPKAPSWPNDPTRPTGKVEAWSHGGGAPWQSATFDAETNTIVIGAGNPAPW
NTWARTAPGDDPRNWDSLFTSGQAYVDAATGELKGFYQHTPNDAWDFSGNNEIVLFEYKD
PKTGKTVKAGAHADRNGFFFITDRDKLANGSGYPNRPTALIAAYPFVDGITWAKGFDLKT
GKPIETGNRPPLPKDGADKGESVFVSPPFLGGKNWNPMSYSPDTGLFYIAANHWAMDYWT
EKVSYKAGSAYLGQGFRIKRLFNDHVGTLRALDPVSGKIVWEHKEEFPLWAGTLATAGGL
VFTGTSDGYVKAFDAKTGKELWKFQTGSGIVSVPITWEMDGEQYIGLSSGYGGAVPLWGG
DMADLTKQVTQGGSFWVFKLPKKLANR
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgcttcggaacccccaaaaacggatcgggccggcgctccgcattgcagcggtggcgatt
gcggtagccagcgcttttacggcatccgccaccccggtcagctgggatgacatcgctaac
gacgccaataccaccgacgacgttttgatgtacgggatgggactcaaaggccagcgcttc
agccctctgacccagatcaacacccaaacggtagctggactcgtgccggcatggtcgttt
tccttcggcggcgaaaaacagcgcggtcaggaagcccaagctctggtccatgacggggtg
atctatgtcacctcgtcgtactcgcgcatcttcgccctcgacgccaggaccggaaagcag
ctatgggcctatgagcaccgtcttccggacgacatccgcccgtgttgcgatgtgatcaac
cgcggcgcggcgatctacggcgacaaggtgttctttggcacgctggacgcatccatcgtg
gccctcgaccgtcagacaggcaaagtggtgtggaagaaaaagtttggcgaccacaagatc
ggctacaccatgaccggcgcccccaccatcgtcaaggaccagaaaagcggccgtgtgctg
ctcgttcacggcagctcaggcgatgaattcggcgtggtcggctacctgtttgcacgcgat
cccgataccggggaagaggtctgggcacgtccgctggtcgaaggccacatgggccgcctc
aacggcaaggacagcacacccaccggcgaccccaaggcgccttcatggcccaacgaccca
actcgtccaaccggcaaggtcgaagcctggagtcacggcggcggcgccccgtggcaaagc
gccacctttgacgccgaaaccaacaccatcgtcatcggcgcgggcaaccccgcgccctgg
aacacctgggcgcgcaccgcaccgggcgacgatccgcgcaactgggacagcctgtttacc
tccggtcaagcttatgtggatgccgcaaccggcgaactcaaaggcttctaccaacacacc
ccgaacgatgcctgggatttttccgggaacaacgagatcgtactcttcgagtacaaggat
ccgaaaaccggcaaaaccgtcaaggccggcgcgcatgccgaccgtaacggctttttcttc
atcaccgaccgagacaagctcgccaacggttccggctatccgaatcgtccaaccgcgctg
atcgccgcttatccctttgtcgacggtatcacctgggccaagggcttcgacctcaagacc
ggcaaaccaatcgaaaccggcaaccgcccgccgttgcccaaggacggcgcagacaaaggc
gaatcggtgttcgtctcgccgccttttctcggcggcaagaactggaacccgatgtcctac
agcccggataccggcctgttctacatcgccgccaaccattgggcaatggactactggacc
gaaaaagtgagctacaaggctggctctgcctatcttggccaaggcttccgcatcaagcgc
ttgttcaatgaccatgtcggcacgctgcgcgcgctcgatccggtctccggcaagatcgtt
tgggaacacaaggaagaattccccttgtgggccggtacgctggccactgccggtggcttg
gtgtttaccggtacctcggacggctacgtcaaagcgttcgatgccaaaaccggcaaggag
ctgtggaagtttcagaccggctccggcatcgtctcggtaccgatcacctgggaaatggac
ggcgagcagtacatcggcctatccagcggctatggcggcgcggtgccgctgtggggcggc
gatatggcagacctcaccaagcaggtcacgcagggcggctcattctgggtcttcaaactg
cccaagaaattagcgaaccgctaa

DBGET integrated database retrieval system