Zoogloeaceae bacteirum Par-f-2: C3497_12165 Help Entry C3497_12165       CDS       T05440                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism zpa  Zoogloeaceae bacteirum Par-f-2 Brite KEGG Orthology (KO) [BR:zpa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:zpa03036]     C3497_12165 (ftsL) Chromosome and associated proteins [BR:zpa03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     C3497_12165 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  AVZ80102 LinkDB All DBs Position complement(2562216..2562482) Genome browser AA seq 88 aa AA seqDB search MIRLGAFILALVVASALGVVAAQHQARKLFAELEREQARARALEVEWGQLQLEQSTWAAH ARIERMARETLGMRAPVSGQMIVVELGE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgatccgtctgggcgctttcatccttgctttggtggtggccagcgccctgggggtagtg gccgcgcagcaccaggcgcgcaagctgttcgccgagctggagcgtgagcaggcgcgcgcc cgcgcgctcgaagtcgagtgggggcagttgcagctcgaacaaagcacctgggccgctcat gcgcgcatcgaacgcatggcgcgcgagacgctgggcatgcgtgcgccggtctccggtcag atgatcgttgtggagctaggcgaatga

DBGET integrated database retrieval system