KEGG   Zygosaccharomyces rouxii: ZYRO0F10714g
Entry
ZYRO0F10714g      CDS       T01118                                 
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04111  Cell cycle - yeast
zro04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:zro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    ZYRO0F10714g
   04113 Meiosis - yeast
    ZYRO0F10714g
SSDB
Motif
Pfam: Fungal_TACC TPR_MLP1_2 Crescentin ATG16 Phage_GP20 DUF5767
Other DBs
NCBI-GeneID: 8205429
NCBI-ProteinID: XP_002497663
UniProt: C5DY69
LinkDB
Position
F:871970..874096
AA seq 708 aa
MNSAPTTPGRSIENQNGSKSAETVGTHLRRHAHGLSSKRRLAPRVSSPLPKDNDTTTIDK
MDVNTMFDTDKSLVKMNHSPIRIDLSSPTRPEESVDRPIPEPKRLKLELASAPNLSQPDT
GIEMIEMLDPKNSPQKEHDEDPFELEEAIRESKENQDSVANTPNSNEKMNSILDLHKLTP
VYNDGEMEDQNDTPGEDLFRIVSKRNEDLVTQLHHLNRSINEVISSCDSTVGKYRRQIDS
LRQDYESKLEDRMSEMASVIQESNTYKERFNIARRRVSETRDEIKMINQNQSILRNKYEG
ATAELEECRRKLNELEEENSKLKSESSENGIKFSRLENMYQEALRRTQNLETANQNVLDA
QAESDRKLDALSHELDDRSEECQKLKAQLEETLAAQEGGRDEKTRQLEELLRHREELESR
ISTLQKEYTHREENLQSKVQNLETELKSINQNTHTHESNEAQLRQELESKVQECQHWQKN
YETVNDDVEILRAEVKELYSDIDEHKELKHYLETSIAQLEEQVNGWRHKYEEHRKDYDKV
LLELDSIHLKYNNTEGEHLTELEQLHDNLSSLQITLKKDSELISQLTRKNETLEFQLKDL
QTPSDVPQLHKEIESWKEKFYNKEAESNRSLKLLAEDLYIQYSSKHEQKVKLLKKGYETR
YQGKLDKLSLQNEGLEQEVDQLKSQLATERKEKQKLIGLLENQTNEAT
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgaattctgctcccacgacacctggtagatccattgaaaatcaaaatggatctaaatca
gctgaaaccgttggtacccatttgagaagacatgcccatggattatctagtaaaagaaga
ttggcacctagagttagttcaccgctaccgaaagataatgatactacaactatcgataag
atggatgtcaatacaatgtttgataccgacaagagcctggttaaaatgaatcattcaccg
ataaggattgacctaagttcgcctactagacctgaagaatcggttgaccgcccaattcct
gaacctaaaagattaaaactagaattagcatcagcacctaacctctcacaaccagatact
ggtatcgaaatgattgaaatgttggaccccaaaaatagtcctcaaaaggaacatgatgaa
gatccgtttgagttggaagaagcgattagagagtccaaagagaatcaagatagtgttgct
aatacacctaatagcaatgaaaaaatgaacagcattttagacttgcacaaattaacccca
gtctacaacgatggagaaatggaggaccaaaacgatacacccggagaagacttattccga
atagtatccaagagaaatgaggatctcgtaactcaacttcatcatttaaacagaagcatc
aatgaagtgataagcagctgtgattctaccgttggtaaatatagaaggcagattgatagt
ttgaggcaagattatgaatcgaaattagaggatagaatgagtgaaatggcttcagtaatt
caggaatctaacacttataaggaaagattcaatattgctaggcgtagggttagtgaaact
agagatgaaattaagatgataaaccaaaaccaatcgattttaaggaataaatatgaaggg
gcaacagctgagttggaagagtgcaggaggaaattaaacgaattggaggaggaaaattca
aaattgaaatctgaatcttcggaaaatggtatcaaattttcgagactagagaacatgtat
caggaggcgctgcggcggacacagaacttagaaactgcgaatcaaaatgtattagacgca
caagctgaatcagatagaaaattagatgcattaagccacgaattagatgacagaagtgaa
gaatgtcaaaagttaaaagctcaattggaagaaactttagcggctcaggaaggtggtagg
gacgaaaagacaagacaactagaagagttgctacgtcatcgagaagaattagagtcacga
atatctactttacagaaagaatatacgcacagagaagaaaatttacaatcgaaggtacag
aacttggaaacagaactaaaatcgattaatcaaaacacgcatactcatgaatctaacgag
gctcaactaagacaagagctggaatccaaggtgcaagagtgccaacattggcagaaaaat
tacgaaacggttaatgacgatgtggaaattcttagagcagaagttaaagagctttattcc
gacattgatgagcataaagaactaaaacactatttagaaacctctattgcccaattagag
gaacaggtaaatggatggcgccataaatatgaagagcatcgtaaagattacgacaaagtg
ctattagaattggatagtatacatctgaagtacaacaacacagagggtgagcatttaacg
gaattagaacaattgcacgataatctaagttctttgcaaataaccctcaagaaggattca
gaactaatttctcaattgactcgtaaaaacgaaactttggaattccaattgaaagatcta
caaactccatctgatgtaccgcaattgcacaaagaaatagaatcgtggaaggagaaattt
tataacaaagaagctgaatctaacagatctctcaaactgctggcagaagatctctacatc
cagtattcatccaagcatgaacaaaaggtgaaactactaaagaagggttacgaaaccaga
tatcagggcaaactggacaaattatcattacaaaatgaaggccttgaacaggaggtagac
cagttgaaatctcaattagctacagaacgcaaggaaaagcagaaacttatcggcctgcta
gagaatcaaactaacgaagccacctag

DBGET integrated database retrieval system