Zymoseptoria tritici: MYCGRDRAFT_19110 Help Entry MYCGRDRAFT_19110  CDS       T02285                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ztr  Zymoseptoria tritici Pathway ztr03010   Ribosome ztr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ztr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MYCGRDRAFT_19110   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MYCGRDRAFT_19110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ztr03011]     MYCGRDRAFT_19110    04121 Ubiquitin system [BR:ztr04121]     MYCGRDRAFT_19110 Ribosome [BR:ztr03011]  Ribosomal proteins   Eukaryotes    Large subunit     MYCGRDRAFT_19110   Archaea     MYCGRDRAFT_19110 Ubiquitin system [BR:ztr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MYCGRDRAFT_19110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Ubiquitin_5 TBK1_ULD DUF2604 UBL_UBAC1 Plexin_RBD Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  13398146 NCBI-ProteinID:  XP_003848901 JGI:  Mycgr3_19110 UniProt:  F9XLE3 LinkDB All DBs Position 10:941292..941590 Genome browser AA seq 74 aa AA seqDB search FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK ESTLHLVLRLRGGI NT seq 222 nt NT seq  +upstreamnt  +downstreamnt ttcgtgaagaccctcacgggcaagactatcaccctcgaggtggagtcgtccgacaccatc gacaacgtcaagagcaagatccaggataaggagggcattccaccggaccaacagcgattg atcttcgccggaaagcaactcgaggatggccgaactcttagcgactacaacatccagaag gagtcgactctccacttggttctccgtctccgtggtggaatc

DBGET integrated database retrieval system