Zymoseptoria tritici: MYCGRDRAFT_31186 Help Entry MYCGRDRAFT_31186  CDS       T02285                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ztr  Zymoseptoria tritici Pathway ztr03010   Ribosome ztr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ztr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MYCGRDRAFT_31186   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MYCGRDRAFT_31186  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ztr03011]     MYCGRDRAFT_31186    04121 Ubiquitin system [BR:ztr04121]     MYCGRDRAFT_31186 Ribosome [BR:ztr03011]  Ribosomal proteins   Eukaryotes    Large subunit     MYCGRDRAFT_31186   Archaea     MYCGRDRAFT_31186 Ubiquitin system [BR:ztr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MYCGRDRAFT_31186 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD TUG-UBL1 Motif Other DBs NCBI-GeneID:  13397864 NCBI-ProteinID:  XP_003851124 JGI:  Mycgr3_31186 UniProt:  F9XFX9 LinkDB All DBs Position 7:complement(1243331..1243619) Genome browser AA seq 76 aa AA seqDB search FQLFIKTLTGRTLTFEVYPSMTIMQLLEQLNWRLGTPLAMMHRLIFAGKQLEGHRDLEWY NIQKECTLHMVLRLRG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt ttccagctgttcatcaagaccctcactggcaggactttgacctttgaagtctacccgtcg atgacgatcatgcagctcctcgagcagctcaactggagactgggcacaccactggccatg atgcatcgcctcatcttcgctggcaagcaactggagggtcatcgtgacctggagtggtac aacattcaaaaggagtgtactctgcacatggtgctgagattgagagga

DBGET integrated database retrieval system