Zymoseptoria tritici: MYCGRDRAFT_33657 Help Entry MYCGRDRAFT_33657  CDS       T02285                                  Name (RefSeq) hypothetical protein   KO K11253   histone H3 Organism ztr  Zymoseptoria tritici Brite KEGG Orthology (KO) [BR:ztr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ztr03036]     MYCGRDRAFT_33657   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ztr04147]     MYCGRDRAFT_33657 Chromosome and associated proteins [BR:ztr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     MYCGRDRAFT_33657 Exosome [BR:ztr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MYCGRDRAFT_33657 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S Motif Other DBs NCBI-GeneID:  13398097 NCBI-ProteinID:  XP_003856691 JGI:  Mycgr3_33657 UniProt:  F9WX14 LinkDB All DBs Position 1:5081901..5082158 Genome browser AA seq 85 aa AA seqDB search LFEDTNLCAIHAKRVTIQSKDIQLARRLRAWYISPSSTSQNSRHASDLSPALLLSRSICS CAIANAYLYIGSSIVQGQEGLHSCR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ctcttcgaggacaccaacctgtgcgccatccacgccaaacgtgtcaccatccagagcaag gacatccagcttgcccgccgtctccgagcatggtatataagcccaagcagcacttctcag aactccagacacgctagtgacttgagccctgctctattgctctctcgctcgatatgcagt tgtgcaatagctaacgcttatctgtatatagggtcgtcaatcgtccaaggccaagaaggc ctccactcttgccggtga

DBGET integrated database retrieval system