Zymoseptoria tritici: MYCGRDRAFT_51258 Help Entry MYCGRDRAFT_51258  CDS       T02285                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism ztr  Zymoseptoria tritici Pathway ztr03060   Protein export ztr04141   Protein processing in endoplasmic reticulum ztr04145   Phagosome Brite KEGG Orthology (KO) [BR:ztr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MYCGRDRAFT_51258    04141 Protein processing in endoplasmic reticulum     MYCGRDRAFT_51258  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MYCGRDRAFT_51258  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ztr04131]     MYCGRDRAFT_51258   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ztr02044]     MYCGRDRAFT_51258 Membrane trafficking [BR:ztr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     MYCGRDRAFT_51258 Secretion system [BR:ztr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    MYCGRDRAFT_51258 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE DUF357 Motif Other DBs NCBI-GeneID:  13400841 NCBI-ProteinID:  XP_003847785 JGI:  Mycgr3_51258 UniProt:  F9XPW6 LinkDB All DBs Position 13:complement(416984..417359) Genome browser AA seq 69 aa AA seqDB search MDQAKDLLEMPREFLKDGRGFLTRCSKPDKREFIRISQAVGMGFLIMGVIGYIVKLIHIP VNNILVGGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaccaagccaaagacctcctcgaaatgccgcgcgaattcctcaaagacggccgcggc ttcctcacacgctgcagcaaacccgacaagcgcgaattcatccgcatctcgcaagccgtg ggcatggggtttctgattatgggagtgattggttacatcgtcaagctgatccacatcccg gtgaacaacatcctcgttggcggcgcatag

DBGET integrated database retrieval system