Zymoseptoria tritici: MYCGRDRAFT_55886 Help Entry MYCGRDRAFT_55886  CDS       T02285                                  Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism ztr  Zymoseptoria tritici Pathway ztr03018   RNA degradation ztr03040   Spliceosome Brite KEGG Orthology (KO) [BR:ztr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     MYCGRDRAFT_55886   09123 Folding, sorting and degradation    03018 RNA degradation     MYCGRDRAFT_55886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ztr03019]     MYCGRDRAFT_55886    03041 Spliceosome [BR:ztr03041]     MYCGRDRAFT_55886 Messenger RNA biogenesis [BR:ztr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      MYCGRDRAFT_55886   mRNA degradation factors    5'-3' decay     Lsm complex      MYCGRDRAFT_55886 Spliceosome [BR:ztr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     MYCGRDRAFT_55886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  13400723 NCBI-ProteinID:  XP_003855145 JGI:  Mycgr3_55886 UniProt:  F9X381 LinkDB All DBs Position 2:3054402..3055208 Genome browser AA seq 83 aa AA seqDB search MDKDINVKFNGGREVTGTLKGYDQLMNLVLDNVKEMTRDEEGNTSSRSLGLLVVRGTLLV LISPLDGSEEIANPFVVQDDDDE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggacaaggacatcaatgtgaagttcaacggcggcagagaagtaacggggactttgaag ggatatgatcagctcatgaatctggttctggacaatgtcaaggaaatgacaagagatgag gagggcaacacaagttctcgctctcttggtctcctggtggtccgcggcacattactggta ttgatctcgccactggatggaagcgaggagattgcgaatccattcgtggtccaggatgac gacgacgaataa

DBGET integrated database retrieval system