Zootoca vivipara (common lizard): 118078480 Help Entry 118078480         CDS       T07275                                  Name (RefSeq) tubulin beta chain   KO K07375   tubulin beta Organism zvi  Zootoca vivipara (common lizard) Pathway zvi04145   Phagosome zvi04517   IgSF CAM signaling zvi04540   Gap junction zvi04814   Motor proteins zvi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:zvi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     118078480  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     118078480   09144 Cellular community - eukaryotes    04540 Gap junction     118078480   09142 Cell motility    04814 Motor proteins     118078480  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118078480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:zvi03036]     118078480   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:zvi04812]     118078480    04147 Exosome [BR:zvi04147]     118078480 Chromosome and associated proteins [BR:zvi03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      118078480 Cytoskeleton proteins [BR:zvi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     118078480 Exosome [BR:zvi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118078480   Exosomal proteins of colorectal cancer cells    118078480   Exosomal proteins of bladder cancer cells    118078480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin_C Motif Other DBs NCBI-GeneID:  118078480 NCBI-ProteinID:  XP_034958253 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP RGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDL VSEYQQYQDATADEQGEFEEEGEEDEA NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgatggcggcctgcgacccgcgccacgggcgctacctgacggtggcggccattttccgg ggcagaatgtccatgaaggaagtggacgagcagatgctcaacgtccagaacaagaacagc agctattttgtcgagtggatccccaacaacgtcaagacggccgtgtgcgacatccctccg cgaggcctcaagatgtccgccaccttcattggcaacagcacggccatccaggagctcttc aagaggatctccgagcagttcacagccatgttccgccgcaaggccttcctgcactggtac accggagagggcatggatgagatggagttcaccgaggccgagagcaacatgaatgacctg gtctccgaataccagcaataccaagacgccacagcggatgagcagggagagtttgaagag gaaggcgaggaagacgaggcttag

DBGET integrated database retrieval system