Zootoca vivipara (common lizard): 118078948 Help Entry 118078948         CDS       T07275                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism zvi  Zootoca vivipara (common lizard) Pathway zvi04810   Regulation of actin cytoskeleton zvi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:zvi00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118078948  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118078948  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zvi04131]     118078948   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:zvi04812]     118078948    04147 Exosome [BR:zvi04147]     118078948 Membrane trafficking [BR:zvi04131]  Others   Actin-binding proteins    Others     118078948 Cytoskeleton proteins [BR:zvi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      118078948 Exosome [BR:zvi04147]  Exosomal proteins   Proteins found in most exosomes    118078948 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  118078948 NCBI-ProteinID:  XP_034958848 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MLFGNLWFRVIWGEGAQYCGFGIRGGSFLGGQLSILTFPPLLFNPPPPQPAEVNILVGKD RSNLFVNGLTLGGQKCSVIRDSLHTDGECTMDLRTKSTGGAPTFNITAAMTAKTIVLVMG KEGVH NT seq 376 nt NT seq  +upstreamnt  +downstreamnt atgctatttgggaacctgtggtttagggttatttggggagagggcgctcagtactgtggc tttgggatccgcggtgggtcttttttggggggccagctgtcgattctcactttcccccct cttctttttaaccccccccccccgcagccggcggaagtgaacatccttgtgggcaaagac cggagcaacctgtttgtcaatggcctgactctgggcgggcagaagtgctctgtcatccgg gacagccttcacacggacggcgagtgcaccatggacctgcggaccaagagcactgggggg gcccccaccttcaacatcacagccgccatgacggccaagacgatagtcctggtgatgggc aaggaaggcgtccacg

DBGET integrated database retrieval system