KEGG   Zootoca vivipara (common lizard): 118081788
Entry
118081788         CDS       T07275                                 
Name
(RefSeq) S-phase kinase-associated protein 1-like
  KO
K03094  S-phase kinase-associated protein 1
Organism
zvi  Zootoca vivipara (common lizard)
Pathway
zvi03083  Polycomb repressive complex
zvi04110  Cell cycle
zvi04114  Oocyte meiosis
zvi04120  Ubiquitin mediated proteolysis
zvi04141  Protein processing in endoplasmic reticulum
zvi04310  Wnt signaling pathway
zvi04350  TGF-beta signaling pathway
zvi05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:zvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    118081788
   04120 Ubiquitin mediated proteolysis
    118081788
  09126 Chromosome
   03083 Polycomb repressive complex
    118081788
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    118081788
   04350 TGF-beta signaling pathway
    118081788
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    118081788
   04114 Oocyte meiosis
    118081788
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    118081788
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zvi04131]
    118081788
   04121 Ubiquitin system [BR:zvi04121]
    118081788
   03036 Chromosome and associated proteins [BR:zvi03036]
    118081788
Membrane trafficking [BR:zvi04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    118081788
Ubiquitin system [BR:zvi04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     118081788
   Cul7 complex
     118081788
Chromosome and associated proteins [BR:zvi03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     118081788
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     118081788
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 118081788
NCBI-ProteinID: XP_034964110
LinkDB
Position
LG3:36761327..36761988
AA seq 155 aa
MPSIKLQSSDGKIFEVDVEIAKQSVTIKTMLEDLGMDDDPVPLPNVNAAILKKVTHQKDD
PPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLEVTCKTVANMIK
GKTPEEIRKTFNIKNDFTEEEEAQVHKENQWCEEK
NT seq 468 nt   +upstreamnt  +downstreamnt
atgccttcaattaaactgcagagttctgatggaaaaatatttgaggtcgacgttgaaatt
gcaaagcagtctgtaaccatcaagacaatgttggaagatttgggaatggatgatgatcct
gtccctcttccaaacgttaatgcagctatattaaaaaaggtaacccaccaaaaagatgac
ccacctccccctgaggatgatgaaaacaaagagaaacgaacagatgacatccctgtgtgg
gaccaagaatttcttaaagtagaccaaggaactctctttgaacttatcctggctgcaaac
tacttagacatcaaaggcttacttgaagtgacgtgcaagacagttgcaaatatgattaag
gggaaaacaccagaagaaatccgcaagaccttcaatatcaagaatgacttcactgaagaa
gaagaagcccaggtacacaaagaaaaccagtggtgtgaagaaaagtga

DBGET integrated database retrieval system