KEGG   Zootoca vivipara (common lizard): 118084802
Entry
118084802         CDS       T07275                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
zvi  Zootoca vivipara (common lizard)
SSDB
Motif
Pfam: MRAP SVIP PspB DUF92
Other DBs
NCBI-GeneID: 118084802
NCBI-ProteinID: XP_034970674
LinkDB
Position
LG5:48935775..48946924
AA seq 104 aa
MANKTNSSSFTYDFEYYMDYLDLLPVDAGKLKANRYSIVIALWIGLASFVAFLFLILFYI
SRSGSTPVKKVSNRSDKDEERRKKPHDAANKRHKNLNSRCASIL
NT seq 315 nt   +upstreamnt  +downstreamnt
atggctaacaagacaaattcatccagttttacttacgattttgaatattacatggattat
ttagatttacttccagttgatgcaggaaagttgaaggcaaacagatattcaattgtcata
gccctttggattggacttgcttcttttgtggcatttcttttccttattttgttctatata
tctcgttctggttctacacccgtgaagaaagtctccaacagatctgataaagatgaagaa
agaaggaaaaaaccacatgatgctgcaaacaagagacataaaaacctaaattccagatgt
gccagtattttgtga

DBGET integrated database retrieval system