Zootoca vivipara (common lizard): 118086006 Help Entry 118086006         CDS       T07275                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism zvi  Zootoca vivipara (common lizard) Brite KEGG Orthology (KO) [BR:zvi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:zvi03019]     118086006    03029 Mitochondrial biogenesis [BR:zvi03029]     118086006 Messenger RNA biogenesis [BR:zvi03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      118086006 Mitochondrial biogenesis [BR:zvi03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     118086006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  118086006 NCBI-ProteinID:  XP_034973100 LinkDB All DBs Position LG6:complement(45788008..45790838) Genome browser AA seq 63 aa AA seqDB search MDSQDCPCCSGGACTCGNNCQCKNCKCKSCRKSCCSCCPVGCSKCAQGCICKGPPSTKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggattctcaggactgtccctgttgtagtggtggtgcatgcacctgtggcaacaactgt cagtgcaaaaactgcaagtgcaagtcatgcagaaagagttgctgttcctgttgtccggtg ggctgcagcaagtgtgcccagggatgtatctgcaaaggtcccccttccaccaaatgcagc tgctgcaagtga

DBGET integrated database retrieval system