Zootoca vivipara (common lizard): 118087468 Help Entry 118087468         CDS       T07275                                  Name (RefSeq) histone H2A.V   KO K11251   histone H2A Organism zvi  Zootoca vivipara (common lizard) Pathway zvi03082   ATP-dependent chromatin remodeling zvi04217   Necroptosis Brite KEGG Orthology (KO) [BR:zvi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     118087468  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118087468  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:zvi03036]     118087468   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zvi04147]     118087468 Chromosome and associated proteins [BR:zvi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118087468 Exosome [BR:zvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118087468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  118087468 NCBI-ProteinID:  XP_034976018 LinkDB All DBs Position LG6:89708335..89720283 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaggctggcaaggacagtggaaaggctaaggcaaaggcagtgtctcgc tcacaaagagctggacttcagttcccagtgggtcgtatccatagacacttgaagactcgc accacaagccatggacgagttggtgctactgctgctgtgtacagtgctgcaattctcgaa tacctcactgctgaggttttggaattggcaggtaatgcctccaaggatctcaaggtaaaa cgtatcactcctcgtcatttgcagcttgctattcgtggtgatgaggaattggattccctt attaaagctaccattgctggtggaggtgtaattcctcacatccacaagtctctgattgga aagaaggggcagcagaaaactgcatag

DBGET integrated database retrieval system