Zootoca vivipara (common lizard): 118094231 Help Entry 118094231         CDS       T07275                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism zvi  Zootoca vivipara (common lizard) Pathway zvi04010   MAPK signaling pathway zvi04137   Mitophagy - animal zvi04140   Autophagy - animal zvi04218   Cellular senescence zvi04371   Apelin signaling pathway zvi04625   C-type lectin receptor signaling pathway zvi04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:zvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118094231 (RRAS)    04371 Apelin signaling pathway     118094231 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118094231 (RRAS)    04137 Mitophagy - animal     118094231 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     118094231 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118094231 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118094231 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zvi04147]     118094231 (RRAS)    04031 GTP-binding proteins [BR:zvi04031]     118094231 (RRAS) Exosome [BR:zvi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118094231 (RRAS)   Exosomal proteins of bladder cancer cells    118094231 (RRAS) GTP-binding proteins [BR:zvi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118094231 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 P-loop_TraG Motif Other DBs NCBI-GeneID:  118094231 NCBI-ProteinID:  XP_034990299 LinkDB All DBs Position LG13:complement(15189792..15201111) Genome browser AA seq 203 aa AA seqDB search MMNPKEGAAPLEKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICNIDGTS TRLDILDTAGQEEFGAMREQYMRTGEGFLLVYAINDRGSFNEIHKFHTQILRVKDRDDFP MILVGNKADLDLYRQVPKEEALSFARENRIPYMEASAKIRLNVDESFYELVRAIRRFHEL ESPPAPAVSPKKKESKGCPCSLL NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgatgaatcccaaggaaggcgcggcgccgctggagaaatacaagctggttgtggtcggc ggaggcggcgtgggcaagagcgccctcacaatccaattcatccagtcgtattttgtctca gactatgaccccacaattgaggactcgtacacaaaaatctgcaacatcgatggcacctcc acacggctggatattctggacacagctggccaggaggagtttggggccatgcgagagcag tacatgcgtactggggaaggtttcctcctcgtctatgccatcaatgatcgtggcagtttc aatgagatccacaagtttcacactcagatacttcgagtgaaagaccgtgatgactttccc atgatccttgtggggaataaggctgaccttgacctttatcggcaggtacccaaggaggag gctctcagctttgcccgggagaatcggatcccgtacatggaagcctctgctaaaatccgc ctcaacgtggatgaatctttctatgagctggtcagggccatcaggaggtttcatgagctg gaatccccccctgccccggctgtcagccctaagaagaaagaaagcaaaggctgcccttgt tccctgctgtaa

DBGET integrated database retrieval system