Zootoca vivipara (common lizard): 118097793 Help Entry 118097793         CDS       T07275                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism zvi  Zootoca vivipara (common lizard) Pathway zvi04081   Hormone signaling zvi04144   Endocytosis zvi04150   mTOR signaling pathway zvi04270   Vascular smooth muscle contraction zvi04310   Wnt signaling pathway zvi04350   TGF-beta signaling pathway zvi04510   Focal adhesion zvi04517   IgSF CAM signaling zvi04520   Adherens junction zvi04530   Tight junction zvi04621   NOD-like receptor signaling pathway zvi04625   C-type lectin receptor signaling pathway zvi04810   Regulation of actin cytoskeleton zvi05100   Bacterial invasion of epithelial cells zvi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:zvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118097793    04350 TGF-beta signaling pathway     118097793    04150 mTOR signaling pathway     118097793   09133 Signaling molecules and interaction    04081 Hormone signaling     118097793    04517 IgSF CAM signaling     118097793  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118097793   09144 Cellular community - eukaryotes    04510 Focal adhesion     118097793    04520 Adherens junction     118097793    04530 Tight junction     118097793   09142 Cell motility    04810 Regulation of actin cytoskeleton     118097793  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118097793    04625 C-type lectin receptor signaling pathway     118097793   09153 Circulatory system    04270 Vascular smooth muscle contraction     118097793  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118097793    05100 Bacterial invasion of epithelial cells     118097793  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zvi04131]     118097793   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zvi04147]     118097793    04031 GTP-binding proteins [BR:zvi04031]     118097793 Membrane trafficking [BR:zvi04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     118097793 Exosome [BR:zvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118097793   Exosomal proteins of other body fluids (saliva and urine)    118097793   Exosomal proteins of colorectal cancer cells    118097793   Exosomal proteins of bladder cancer cells    118097793 GTP-binding proteins [BR:zvi04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     118097793 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  118097793 NCBI-ProteinID:  XP_034996921 LinkDB All DBs Position LG16:complement(39132498..39147740) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKTSCQLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatacgcaagaaacttgtcattgtaggagatggagcatgtggaaagacctgc ctccttattgtcttcagcaaggaccaattcccagaggtctacgtccccaccgtctttgag aactatgtggctgacattgaggtggatggaaagcaggtagaacttgccctgtgggataca gctggccaagaggactatgaccggctaagacccctctcctacccagatacagacgtcatc ctcatgtgtttctccattgacagccccgacagtttagagaacatccctgagaagtggact ccggaggtgaagcacttctgccccaatgtgcctatcatcctggtggggaacaagaaggac ctgcgtaatgatgagcatacacgccgggagctagccaagatgaagcaggaaccagtgaag ccagaggagggacgtgacatggcaaacaggattagtgcttttggctacctggaatgttct gcaaagacaaaggatggagtacgggaagtgtttgagatggccacccgggctgccctacag gccaaacgtgggcgcaagaagacctcatgccagctgctgtaa

DBGET integrated database retrieval system