KEGG   Cricetulus griseus (Chinese hamster): 100750575Help
Entry
100750575         CDS       T02813                                 

Gene name
Kmt2b
Definition
(RefSeq) lysine methyltransferase 2B
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100750575 (Kmt2b)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100750575 (Kmt2b)
Transcription factors [BR:cge03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100750575 (Kmt2b)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100750575 (Kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     100750575 (Kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD zf-CXXC zf-HC5HC2H FYRN zf-HC5HC2H_2 Bromodomain PHD_2 RAG2_PHD Nop14
Motif
Other DBs
NCBI-GeneID: 100750575
NCBI-ProteinID: XP_007622570
LinkDB All DBs
Position
Un
AA seq 2528 aa AA seqDB search
LLFLPFTPGPLNQEFQGFHSDEDVAPSSLRSALRSQRGRAPRGRGRKHKTTPPPPPPRLA
DAAPAPPKAPSRKRGEEGTERMVQALTELLRRAQAPQAPRSRACEPSTPRRSRGRPPGRP
AGPCRKKQRAVVVAEAAVTIPKPEPPPPVVPVKNRTGSWKCKEGPGPGPGTPKRGGQPGR
GGRGGRGRGRGGLPLMIKFVSKAKKVKMGQLSQGLESGQGHGQHGESWQDAPQRRDEDEQ
EGGPCCKKAEQKLEEEGEEKEEKEDSSEDREEEAEAAVTEEEEMLASPLPPPVSPPPPVS
PPPHAASEKQEESPRPVVPATCSRKRGRPPLTPSQRAEREAARSGPEGTLSPSPSPSAAT
GSPLEDSPPVAPKSATFLKNIRQFIMPVVSARSSRVIKTPRRFMDEDPPKPPKVEASIAR
PPVATSPLAPQEPVPVPSPPRVPTPPSTPVPLPEKRRSILREPTFRWTSLTRELPPPPPA
PPPAPSPPAPSPPPTPATPSRRPLLLRAPQFTPSEAHLKIYESVLTPPAPLGALETPEPE
LPPAADDPPAEPEPRAVGRTNHLSLPRFVPVVTTPVKVEVPPSGAPALSSGEQPVPVQAQ
LQQPPQVLPQALPPQQPQVQPQAQLQPPPSPQHTPPLEKARVASLGPLPLSGVEEKMFSL
LKRAKVQLFKIDQQQQQKVAASMAPSPAVQTEEAVGTVKQTPDRGSVKSEDESMDTKKER
ASGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLATEDTSSASET
ESVPSRSQREKVESTGPGGDLEPTGSAGSLAHTPRRSLPSHHGKKMRMARCGHCRGCFRV
QDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGRTIVKTLLPWDSDES
PEASPGPPGPRRGAGAGGPREEVGATPGPEEQDSLLLQRKSARRCVKQRPSYDVFEDSDD
SEPGGPPAPRRRTPREHELPVLEPEEQSRPRKPTLQPVLQLKARRRLDKDALASGPFASF
PNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGPPMVCLLCASKGLHE
LVFCQVCCDPFHPFCLEEAERPLPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHA
YHPACLGPSYPTRATRRRRHWICSACVRCKSCGATPGKNWDVEWSGDYSLCPRCTELYEK
GNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGPCA
GATQPRWREALSGALQGGLRQVLQGLLSSKVAGPLLLCTQCGQDGQQLHPGPCDLQAVGQ
RFEEGHYKSVHSFMEDVVAILMRHSEEGEPPERRAGGQMKGLLLKLLESAFCWFDAHDPK
YWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQESETPESGQPPGDPSAAFQSKDPAAFSH
LDDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVA
RGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQDDKKVFCQKHTDLLDGKEI
VTPDGFDVLRRVYVDFEGINFKRKFLTGLEPDVINILIGSIRINSLGTLSDLSDCEGRLF
PIGYQXELYWSTVDARRRCWYRCRILEYRPWGPREEPVHLEAAEENQTIVHSPTPSSEPP
NHDNLPDADPLIPGDPGHHSPVQSLDPPLRTDPSSGPPPTPRSFSGARIKVPNYSPSRRP
LGGVSFGPLPSPGSPSSLTHHIPTVGDSDFPAPPRRSRRPSPLATRPPPSRRTSSPLRTS
PQLRVPLSTSVTALTPTSGELAPPDLAPSPLPPPEDLGPDFEDMEVVSALSAADLDFAAS
LLGTEPFQEEIVAAGAVGSSQAGPGDSSEEEASPTTRYVHFPVTVVSSPALAPSSLTGAP
RIEQLDGVDDGTDSEAEAVQQSRGQGTPPSGPGVGRGGVIGAAGDRARPPEDLPSEIVDF
VLKNLGGPGEGAAGPREESLPSAPPLANGSQPPQGLPASPADPTRTFAWLPGAPGVRVLS
LGPAPEPPKPATSKIILVNKLGQVFVKMAGEGDPVTAPASGPPSPPRQAIRVKRVSTFSG
RSPPAPPPNKAPRLDEDGESLEDSHQVPGISGSGVSRVRMKTPTVRGVLDLNNTGEPAGE
ESPGPLQDRCPLLPLPEGPARALDGPSDLLFESQWHHYSGEASSSEEEPPSPEDKENQVP
KRAGPHLRFEISSDDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGI
HHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNFL
ASQHRVLPEGAACDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHGR
GLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNA
ARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGA
KRCRRFLN
NT seq 7587 nt NT seq  +upstreamnt  +downstreamnt
ctgctgtttctccccttcacccctggtcccctaaatcaggagtttcagggttttcactca
gatgaagatgtggcccccagttccctgcgctctgcgctccgatcccagcgaggtcgagcc
ccccggggtcggggccgaaagcataagacgaccccccctcctcctcctcctcgactagca
gatgcggctcctgcccccccaaaggccccttctcggaaacggggtgaggaaggcacagaa
cgaatggtgcaggcactgactgaacttctccggcgggcccaggcaccccaagccccccgg
agccgggcatgtgagccctccactccccgtcggtctcggggacggcccccaggacggcca
gcaggcccctgccggaaaaagcagcgagcagtagtggtagcagaagcggctgtgacaatc
cctaaacctgagcctccgcctcccgtggttcccgtaaagaacagaactggcagctggaag
tgcaaggaggggcctggaccaggacctggaacccccaaacgtggaggacagcctgggaga
ggaggccgtggaggcaggggcagaggccgaggaggacttccccttatgatcaagtttgtt
tcgaaggccaaaaaagtgaagatgggacaattgtcccagggactagaatcaggtcagggt
catggtcaacatggagagagctggcaggatgccccccaaagaagagatgaggatgaacag
gagggggggccttgctgcaagaaggcagagcagaaactggaggaggagggcgaggagaag
gaagaaaaggaagacagcagtgaggacagagaagaggaggctgaggctgctgtgactgag
gaggaagagatgctggcgtcccctctgccacccccggtttctcctcctcccccagtgtcc
ccccctccacacgcagcctcagagaagcaagaagagtcgcctcgtcctgtggtcccagct
acttgctctaggaagaggggccggcctcccctgactcctagccagcgggcagagcgggaa
gctgctcggtcaggtccagagggcaccctctctccctctccgagccccagcgccgccaca
gggagccctctggaagacagtcctcccgtggcccccaaaagtgccaccttcctgaagaat
atccggcagtttattatgcctgtggtgagtgcgcgctcttcgcgggttatcaagacaccc
cggcgctttatggacgaagaccctcccaagcctccaaaggtggaggcttccattgctcgg
cctcctgttgccacctccccactcgctccccaggagccggttccagtcccctctccacct
cgtgtcccaacccccccatccaccccagtcccactccctgagaagaggcggtctatccta
agggaacccacatttcgctggacttcgctaacccgggagctgccaccgcctccccctgct
cctccaccagccccatctccgccagctccgtccccgccacctacccctgccactccttcc
cggaggcccctgctccttcgggcccctcagtttaccccaagtgaagcccacctgaagatc
tatgaatcggtgcttacgcctcctgctcctcttggggctcttgaaacccctgagccagag
ctgcctcctgctgctgacgaccctccagctgagcctgagcctagggcagtggggcggacc
aaccacctcagcttgcctcggtttgtccctgtggtcaccactcctgttaaggttgaggtg
ccccccagtggggctccagctctgagcagcggggagcagcctgttcctgttcaggctcag
ctccagcagcccccacaggtcttgccccaggcactaccgccacagcaaccacaagtacag
ccacaggcacagctgcagccacctccatcaccgcaacacacaccaccgctggaaaaggcc
cgtgttgccagtctcggtccactgccactgtctggggtggaggaaaaaatgtttagcctt
cttaaacgagctaaggtgcagctcttcaagatcgatcagcagcagcagcagaaagtcgcg
gcttccatggcgccaagccctgcagtgcaaaccgaggaggctgtggggactgtcaaacag
accccagacagaggctccgtcaagtctgaagatgaatccatggacactaagaaagagaga
gcctcgggccctgaatcgcctgtgcaaggcccccgaatcaaacatgtctgccgtcatgct
gctgtggccttgggccaggctcgggccatggtgcctgaagatgtaccccgcctcagtgcc
ctccctctgcgggatcggcaggacctcgccactgaggatacgtcgtcagcatcagagact
gagagtgtcccatcccgatcccagcgggaaaaggtggaatccacagggcctgggggagac
ttggagcctacagggtctgcagggtccttggcccacacaccacggcggtcactgccatct
caccatggcaagaaaatgagaatggctcgctgcgggcactgtcgtggctgctttcgtgtg
caggactgtggctcttgtgtcaactgcttggataaacctaagtttgggggccccaacact
aagaagcagtgctgtgtataccggaagtgtgacaagatagaggctcggaagatggagcgg
ctagcaaaaaaaggccggacgatagtgaagacgctgttgccctgggattccgatgaatct
cccgaggcctcccctggtcctccaggcccacgccggggggcgggagctggggggccccgg
gaggaggtgggggccactcccgggcccgaggagcaggactccctcctactgcagcgcaag
tcagcccgacgctgcgtcaaacagaggccctcctatgatgtcttcgaggactcggatgac
tcagagcccgggggtccccctgctccaagacgtcgaacccccagagaacatgagctgcca
gtgctagaacctgaggagcagagccggccccgcaaacccaccctgcagcctgtgttgcag
ctcaaggcccgaaggcgcctggacaaggatgctttagcctctggcccctttgcctctttc
cccaatggctggactggaaagcagaagtcccctgatggcgtgcaccgggtccgagtggat
tttaaggaggattgcgacctagagaacgtgtggcttatgggcggcctcagtgtgcttact
tctgtgccaggggggccaccgatggtgtgcctgctgtgtgctagcaaaggcctccatgag
ttggtcttttgccaagtctgctgcgatcctttccaccccttctgtctggaggaggcagaa
cggcccttgccccagcatcgagacacctggtgctgccggcgctgcaagttctgccatgtg
tgtgggcgcaaaggccgtgggtccaagcacctcctggaatgtgaacgctgccgccatgct
taccacccagcctgcctaggacctagctacccaacccgggccacgcgtagacggcgccac
tggatctgctcagcctgtgtgcgctgtaagagctgtggggcaactccaggcaagaactgg
gacgtcgagtggtctggagattacagcctctgccccaggtgcaccgagctctatgagaaa
gggaactactgcccgatttgcacgcgctgctatgaagacaatgactatgagagcaagatg
atgcagtgcgcacagtgtgaccactgggtgcacgccaagtgtgaggggctctcggatgaa
gactatgagatcctttctgggctgccagactcggtgctgtacacgtgtgggccgtgtgcc
ggggcgacacagccccgctggagagaggccctgagtggggccctgcagggaggcctgcgc
caggtgctccagggcctgttgagctccaaggtggcgggcccgttgctgctgtgcacccag
tgtgggcaggatgggcagcagctccacccaggaccctgtgatttgcaagctgtgggacag
cgctttgaggaaggccactataagtcggtgcacagcttcatggaggacgtggtggccatc
ttgatgaggcactcggaagaaggcgagcccccagagcgccgggcggggggccagatgaaa
ggactccttctgaagctgctagagtctgcgttctgctggttcgacgcccatgaccctaaa
tattggcgacggagtacccggctgccgaacggagtcctccccaatgctgtgctgccccca
tccttggaccacgtctatgctcagtggagacagcaagaatcagagaccccagaatctggg
caacctccaggggatccttcagcagcttttcagagcaaggaccccgctgctttctcacac
ctggatgacccccgtcagtgcgcactctgtctcaagtatggggacgctgactccaaggag
gcggggcggctcctgtacattgggcagaatgagtggacgcatgtcaactgtgccatttgg
tcagctgaagtgtttgaggaaaatgacggctcccttaagaatgtccatgccgctgttgca
cgaggaaggcagatgcgctgtgagctctgcctgaagcctggagccacagtgggctgctgc
ctgtcctcctgtctcagcaacttccacttcatgtgcgctcgggccagctactgcatcttc
caggatgacaagaaggttttctgccagaaacacacagacctcctagatggcaaggagatc
gtgacccctgacggttttgatgttctccggcgcgtctacgtggacttcgagggcatcaac
ttcaagcggaagttcttgactgggcttgaaccagatgtcatcaatatactcattggctcc
atcagaatcaactccctgggcaccctgtctgatctctcagactgtgagggtcggctcttc
cccattggctatcagnntgagctgtactggagcacagtggatgctcggaggcgctgctgg
tatcggtgccgaattctagagtatcgcccctgggggccgagggaggagccggtccacctg
gaggcagcagaggagaaccagaccattgtgcatagtcccaccccttcctcagagcccccc
aatcatgacaacctgccagatgcagatcccctgattcctggagaccctggacaccactca
cccgttcagagtctggatccccctcttcggacagatccaagcagtggccctcctcccacc
ccccgctccttctcaggggctcgaatcaaagtgcccaactactcaccatctcggaggccc
ttagggggtgtctcatttggtcctctgccctccccaggaagtccatcttccctgacgcac
cacatccccacagtgggagactcggactttccagctccccccaggcgatctcgccgtcct
agccccctggccaccaggccaccaccatcccggcggacctcctctcctctcagaacttcc
cctcagctcagggtgcccctgtctacctcagtcacagccctcacacctacctcaggggag
ctggctccccctgacctggccccatctcctctgccaccccctgaagacctgggcccagac
tttgaagacatggaggtggtgtcagcactcagtgctgctgacctggacttcgcagccagc
ctgctggggactgagcccttccaggaagagattgtggcagctggggccgtggggagcagc
caggcaggcccaggggacagctcagaggaggaggccagccccaccactcgctatgtccac
ttccctgtgacggtggtgtctagccctgccctggctcccagctccctcactggagcaccc
cgaattgagcaactggatggagtggatgatggcaccgacagcgaggcagaggctgtccag
caatctcggggacaggggactcctccctcaggaccaggagtgggccggggtggagtcatc
ggagcagcaggggacagagcccgacctcctgaagacttgccttcagaaattgtggatttt
gtgttgaagaacctggggggtcctggggagggggctgctggtcccagagaggaatctctc
ccttcggcacctcccttggctaatggcagccaacccccacaaggtctgcccgctagccca
gctgaccctacccggacatttgcctggcttcctggggctccaggggtccgggtattgagt
ctgggtcccgctccagaaccccccaaacctgctacatccaagatcatccttgtcaacaag
ctaggccaagtatttgtgaagatggctggggagggtgaccctgtcacagccccagcaagt
gggccccccagcccaccgcgccaggccatccgggtcaagagggtgtccaccttctctggc
cggtcacctccggcacctcccccaaacaaagctccccggctggatgaggatggagaatcc
ttggaggatagccatcaagtgccagggatcagtggcagtggggtcagccgtgtacggatg
aagacgcccacagtgcgaggggttctggacttgaacaatactggggagcctgctggggag
gaaagccctgggccccttcaggaccggtgccctttgctgccacttccagaaggtcctgcc
cgggcccttgatggcccctcagacctgctctttgagtcgcagtggcatcactattcaggt
gaggcctcaagctctgaggaggagcctccatccccagaggacaaagaaaaccaggttccc
aaacgagctggtccgcacctgcgctttgagatcagcagtgatgatggcttcagtgtggag
gccgagagcttggagggggcatggagaactctgattgagaaagtgcaagaggctcgaggg
catgctcggctcaggcatctctcctttagtggaatgagtggagcgcgacttctgggcatc
catcacgatgctgtcatcttcctggcagagcagctgcctggggcccagcgctgccagcac
tataagttccgctaccaccagcagggagagggtcaggaggagccccccctgaacccccat
ggggctgcccgggctgaggtctatctccggaagtgtacctttgatatgtttaacttcctg
gcttcccaacatcgggtgctccctgagggggccgcctgtgatgaggaggaggatgaggtg
cagctccggtccaccagacgtgccaccagcctggaacttcccatggccatgcgctttcgc
catctcaaaaagacgtccaaagaggctgtgggtgtttacagatcagcgatccacgggaga
ggcctgttctgtaagcgcaacatcgacgccggggagatggtcattgagtactctggcatt
gtcattcgctctgtgctgactgacaagcgggagaaattctatgatggaaagggtatcggg
tgctacatgttccgcatggatgactttgacgtggtggacgccaccatgcacggcaatgct
gcccgcttcatcaaccactcgtgtgagcccaactgcttctctcgcgtcatccatgtggaa
ggccagaaacacattgtcatctttgccctgcgacgcatcctgcgaggtgaggagctcacc
tatgactacaagtttcccattgaggatgccagcaacaagctgccctgcaactgtggcgcc
aagcgctgccgtcgcttccttaactga

DBGET integrated database retrieval system