KEGG   Homo sapiens (human): 217Help
Entry
217               CDS       T01001                                 

Gene name
ALDH2, ALDH-E2, ALDHI, ALDM
Definition
aldehyde dehydrogenase 2 family (mitochondrial) (EC:1.2.1.3)
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H01071  
Acute alcohol sensitivity
Drug target
Disulfiram: 
Other: 
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hsa00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:hsa00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12q24.2
AA seq 517 aa AA seqDB search
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgctgccgcccgcttcgggccccgcctgggccgccgcctcttgtcagccgcc
gccacccaggccgtgcctgcccccaaccagcagcccgaggtcttctgcaaccagattttc
ataaacaatgaatggcacgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggccgccttccagctgggctcaccttggcgccgcatggacgcatcacac
aggggccggctgctgaaccgcctggccgatctgatcgagcgggaccggacctacctggcg
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
atccccattgacggagacttcttcagctacacacgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcaactggaaacgtggttgtgatgaaggtagctgagcagacacccctcaccgccctctat
gtggccaacctgatcaaggaggctggctttccccctggtgtggtcaacattgtgcctgga
tttggccccacggctggggccgccattgcctcccatgaggatgtggacaaagtggcattc
acaggctccactgagattggccgcgtaatccaggttgctgctgggagcagcaacctcaag
agagtgaccttggagctgggggggaagagccccaacatcatcatgtcagatgccgatatg
gattgggccgtggaacaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaggaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgatagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacacggggaagcaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcactgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggtggctacaagatgtcggggagtggccgggagttgggcgagtacgggctgcag
gcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system