KEGG   Homo sapiens (human): 217Help
Entry
217               CDS       T01001                                 

Gene name
ALDH2, ALDH-E2, ALDHI, ALDM
Definition
(RefSeq) aldehyde dehydrogenase 2 family member
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H01071  Acute alcohol sensitivity
H01611  Alcohol dependence
Drug target
Cyanamide: D00123
Disulfiram: D00131
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    217 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    217 (ALDH2)
   00620 Pyruvate metabolism
    217 (ALDH2)
  Lipid metabolism
   00071 Fatty acid degradation
    217 (ALDH2)
   00561 Glycerolipid metabolism
    217 (ALDH2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    217 (ALDH2)
   00310 Lysine degradation
    217 (ALDH2)
   00330 Arginine and proline metabolism
    217 (ALDH2)
   00340 Histidine metabolism
    217 (ALDH2)
   00380 Tryptophan metabolism
    217 (ALDH2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    217 (ALDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     217 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 217
NCBI-ProteinID: NP_000681
OMIM: 100650
HGNC: 404
Ensembl: ENSG00000111275
Vega: OTTHUMG00000169603
Pharos: P05091(Tclin)
UniProt: P05091
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12q24.12
AA seq 517 aa AA seqDB search
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgctgccgcccgcttcgggccccgcctgggccgccgcctcttgtcagccgcc
gccacccaggccgtgcctgcccccaaccagcagcccgaggtcttctgcaaccagattttc
ataaacaatgaatggcacgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggccgccttccagctgggctcaccttggcgccgcatggacgcatcacac
aggggccggctgctgaaccgcctggccgatctgatcgagcgggaccggacctacctggcg
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
atccccattgacggagacttcttcagctacacacgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcaactggaaacgtggttgtgatgaaggtagctgagcagacacccctcaccgccctctat
gtggccaacctgatcaaggaggctggctttccccctggtgtggtcaacattgtgcctgga
tttggccccacggctggggccgccattgcctcccatgaggatgtggacaaagtggcattc
acaggctccactgagattggccgcgtaatccaggttgctgctgggagcagcaacctcaag
agagtgaccttggagctgggggggaagagccccaacatcatcatgtcagatgccgatatg
gattgggccgtggaacaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaggaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgatagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacacggggaagcaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcactgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggtggctacaagatgtcggggagtggccgggagttgggcgagtacgggctgcag
gcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system