Streptococcus sp. NPS 308: SNAG_0869 Help Entry SNAG_0869         CDS       T05541                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism strn  Streptococcus sp. NPS 308 Brite KEGG Orthology (KO) [BR:strn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:strn03032]     SNAG_0869 (hup)    03036 Chromosome and associated proteins [BR:strn03036]     SNAG_0869 (hup)    03400 DNA repair and recombination proteins [BR:strn03400]     SNAG_0869 (hup) DNA replication proteins [BR:strn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SNAG_0869 (hup) Chromosome and associated proteins [BR:strn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SNAG_0869 (hup) DNA repair and recombination proteins [BR:strn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SNAG_0869 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_euk_2 HU-DNA_bdg Rpf1_C Motif Other DBs NCBI-ProteinID:  BAV79745 UniProt:  A0A1E1GAB3 LinkDB All DBs Position 836044..836319 Genome browser AA seq 91 aa AA seqDB search MANKQDLIAKVAEATELTKKDSAAAVDAVFAAVTEYLAAGEKVQLIGFGNFEVRERAARK GRNPQTGKEIKIAASKVPAFKAGKALKDAVK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaaacaaacaagatttgatcgctaaagtagcagaagctacagaattgactaagaaa gattcagcagcagcagttgacgctgtattcgcagcagtaactgaataccttgcagctggt gaaaaagttcaattgatcggttttggtaactttgaagttcgtgagcgtgctgcacgtaaa ggtcgcaacccacaaactggtaaagaaatcaagatcgcagcttctaaagttccagcattc aaagctggtaaagctcttaaagacgctgttaaataa

DBGET integrated database retrieval system