Drosophila virilis: 6626916 Help Entry 6626916           CDS       T01066                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism dvi  Drosophila virilis Pathway dvi04814   Motor proteins Brite KEGG Orthology (KO) [BR:dvi00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     6626916  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dvi03037]     6626916    04812 Cytoskeleton proteins [BR:dvi04812]     6626916 Cilium and associated proteins [BR:dvi03037]  Motile cilia and associated proteins   Dynein arm    6626916 Cytoskeleton proteins [BR:dvi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      6626916 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Cyclin_N DUF4854 Motif Other DBs NCBI-GeneID:  6626916 NCBI-ProteinID:  XP_002050970 FlyBase:  FBgn0207047 UniProt:  B4LNI3 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MADDEGGKEGDKKIVHTYPLVKHTDMKEEMRQEVIDLSVSVCEKYSSNYELAAKTIKETM DKKFGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAVVLWKCS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggccgatgatgagggcggcaaggagggcgacaagaaaatcgtgcacacctatccgctg gtcaagcacacggacatgaaggaggagatgcgccaggaggtcatcgacttgagcgtcagt gtgtgcgagaaatactcttcaaattatgagctagctgccaaaacgattaaggagacaatg gacaagaaattcggcatctattggcatgttgttgtcggcgagggttttggctttgaggta tcctatgagactgagaatatactctatctattctttgccggcaacttggccgttgtgctg tggaaatgctcctga

DBGET integrated database retrieval system