Macaca mulatta (rhesus monkey): 697712 Help Entry 697712            CDS       T01028                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04014   Ras signaling pathway mcc04137   Mitophagy - animal mcc04144   Endocytosis mcc04145   Phagosome mcc04148   Efferocytosis mcc04962   Vasopressin-regulated water reabsorption mcc05014   Amyotrophic lateral sclerosis mcc05022   Pathways of neurodegeneration - multiple diseases mcc05132   Salmonella infection mcc05146   Amoebiasis mcc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     697712 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     697712 (RAB5A)    04145 Phagosome     697712 (RAB5A)    04137 Mitophagy - animal     697712 (RAB5A)    04148 Efferocytosis     697712 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     697712 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     697712 (RAB5A)    05152 Tuberculosis     697712 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     697712 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     697712 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     697712 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     697712 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     697712 (RAB5A)    04031 GTP-binding proteins [BR:mcc04031]     697712 (RAB5A) Membrane trafficking [BR:mcc04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     697712 (RAB5A)  Endosome - Lysosome transport     697712 (RAB5A) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    697712 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    697712 (RAB5A)   Exosomal proteins of colorectal cancer cells    697712 (RAB5A)   Exosomal proteins of bladder cancer cells    697712 (RAB5A) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     697712 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  697712 NCBI-ProteinID:  NP_001248077 Ensembl:  ENSMMUG00000006992 UniProt:  H9EST8 LinkDB All DBs Position 2:complement(27761080..27797805) Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggcgcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaggaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggccgacctagcaaataaa agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac ctcaccgaacccacacaaccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system