Myotis brandtii (Brandt's bat): 102257069 Help Entry 102257069         CDS       T02920                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04814   Motor proteins myb05014   Amyotrophic lateral sclerosis myb05016   Huntington disease myb05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:myb00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102257069  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102257069    05016 Huntington disease     102257069    05022 Pathways of neurodegeneration - multiple diseases     102257069  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myb03037]     102257069    04812 Cytoskeleton proteins [BR:myb04812]     102257069 Cilium and associated proteins [BR:myb03037]  Motile cilia and associated proteins   Dynein arm    102257069 Cytoskeleton proteins [BR:myb04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102257069 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF3109 Motif Other DBs NCBI-GeneID:  102257069 NCBI-ProteinID:  XP_005863569 UniProt:  S7PDT0 LinkDB All DBs Position Un AA seq 105 aa AA seqDB search MGEAEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET MDKKFGSSWHVVIGEGFGFEIIHEVKNLLYLYFGGTLAVCMWKCS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggagaagcagaagggaagaaagatgaggctgattataaacgcctacagaccttccct ctggtcaggcactcagacatgccagaggagatgcgagtggagaccatggagctgtgtgtc acggcctgtgagaaattctccaacaacaatgagagtgccgccaagatgatcaaagagacg atggacaagaagttcggctcctcctggcatgtggtgatcggcgagggcttcgggtttgag atcatacacgaggtgaagaacctcctgtacctgtactttggggggacgctggctgtgtgc atgtggaagtgctcctga

DBGET integrated database retrieval system