Prionailurus bengalensis (leopard cat): 122492036 Help Entry 122492036         CDS       T07574                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04014   Ras signaling pathway pbg04137   Mitophagy - animal pbg04144   Endocytosis pbg04145   Phagosome pbg04148   Efferocytosis pbg04962   Vasopressin-regulated water reabsorption pbg05014   Amyotrophic lateral sclerosis pbg05022   Pathways of neurodegeneration - multiple diseases pbg05132   Salmonella infection pbg05146   Amoebiasis pbg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122492036 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122492036 (RAB5A)    04145 Phagosome     122492036 (RAB5A)    04137 Mitophagy - animal     122492036 (RAB5A)    04148 Efferocytosis     122492036 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     122492036 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122492036 (RAB5A)    05152 Tuberculosis     122492036 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     122492036 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122492036 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     122492036 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122492036 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbg04147]     122492036 (RAB5A)    04031 GTP-binding proteins [BR:pbg04031]     122492036 (RAB5A) Membrane trafficking [BR:pbg04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     122492036 (RAB5A)  Endosome - Lysosome transport     122492036 (RAB5A) Exosome [BR:pbg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122492036 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    122492036 (RAB5A)   Exosomal proteins of colorectal cancer cells    122492036 (RAB5A)   Exosomal proteins of bladder cancer cells    122492036 (RAB5A) GTP-binding proteins [BR:pbg04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     122492036 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  122492036 NCBI-ProteinID:  XP_043451439 LinkDB All DBs Position C2:137715029..137745986 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgtcgatttccaggaagcacagtcttatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgctgtagtaactaa

DBGET integrated database retrieval system