Paenibacillus graminis: PGRAT_20915 Help Entry PGRAT_20915       CDS       T03325                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pgm  Paenibacillus graminis Brite KEGG Orthology (KO) [BR:pgm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pgm03032]     PGRAT_20915    03036 Chromosome and associated proteins [BR:pgm03036]     PGRAT_20915    03400 DNA repair and recombination proteins [BR:pgm03400]     PGRAT_20915 DNA replication proteins [BR:pgm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PGRAT_20915 Chromosome and associated proteins [BR:pgm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PGRAT_20915 DNA repair and recombination proteins [BR:pgm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PGRAT_20915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  AIQ69820 UniProt:  A0A089MBT6 LinkDB All DBs Position complement(4647363..4647635) Genome browser AA seq 90 aa AA seqDB search MNKSDLINVVTEATELPKKDATKAVDAVFEAITGALQNGDKVQLVGFGNFEVRERSARKG RNPQTGEEIEIPSSKVPAFKPGKALKDGIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcagatttgatcaacgtggttacagaagcaactgaacttcccaagaaagat gctactaaagcggtagatgccgttttcgaagcgatcacaggtgctctgcaaaacggagat aaagttcagctggtaggattcggaaactttgaagtgcgcgaacgttccgcacgtaaaggc cgcaacccgcaaactggtgaagaaatcgaaattccttcgagcaaggtaccggcattcaaa ccgggtaaagctctgaaagacggaatcaaatag

DBGET integrated database retrieval system