KEGG   Trichophyton benhamiae: ARB_00375Help
Entry
ARB_00375         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
abe  Trichophyton benhamiae
Pathway
abe00020  Citrate cycle (TCA cycle)
abe00310  Lysine degradation
abe00380  Tryptophan metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01200  Carbon metabolism
Module
abe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARB_00375
  09105 Amino acid metabolism
   00310 Lysine degradation
    ARB_00375
   00380 Tryptophan metabolism
    ARB_00375
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ARB_00375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 9526784
NCBI-ProteinID: XP_003013191
UniProt: D4AW11
LinkDB All DBs
AA seq 1050 aa AA seqDB search
MFRTTRAVTLKASGASSLLRQSYTRSICSGARSNLQLTARKPLGVVCARKAWEQTRGYAV
ATGETSKGVDPNDSFLQGNTANYIDEMYMAWKEDPQSVHVSWRTYFHNMEEGKMPISQAF
QPPPTIVPTPTGGVPQHMPGNAAGTNVSNHLKVQLLVRAYQARGHHKAKIDPLGIRGEAD
SFGYSKPKELELSHYGFTEKDLDEEFALGPGILPRFETETRKKMTLREIIDACEKIYCGS
FGVEYIHIPDRVPCDWIRDRIEIPQPYKYSVDEKRRILDRLIWSSSFEAFLATKFPNDKR
FGLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFSGSA
EPSDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRSIQHYNNDE
KEFNTAMGVLLHGDAAFAAQGIVYETMGFHSLPAYSTGGTIHIVVNNQIGFTTDPRFARS
TPYCSDIAKAIDAPVFHVNGDDVEALNHVCQLAADWRAQFKSDVVIDIVCYRKQGHNETD
QPAFTQPLMYKRIASQQSQIDKYVEKLLKEKTFTKEDIDEHKKWVWGMLNDSFERSKDYT
PTSREWLTSAWNGFKTPKELATEVLGHPPTGVEAETLQMIGAKLGSIPENFTPHRNLKRI
LANREKSIKEGQNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENES
TYTALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCII
DQFIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPAADKIDRQ
HQDCNMQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHF
RWIIPDDQHGKQIDEPEKIERVIMCSGQVWAALTKHREANGIRNTAITRIEQMHPFPWQQ
LKENLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASV
ATGLKSSHIKEEQDLLHDAFTVHQEKLKGE
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaacaacaagagctgtgacgctgaaggcgtccggagcttcttcccttctcaga
caatcgtatactcgctcgatatgttctggagcaaggtcaaatcttcagttgacagcccgc
aaacctctgggtgttgtctgtgccagaaaagcctgggagcagactaggggctatgccgtt
gcgactggcgagaccagcaaaggagtggacccaaatgactctttcctccagggcaacacc
gccaactacatcgatgagatgtacatggcctggaaggaggaccctcaaagcgttcacgtt
tcatggcgcacctactttcacaacatggaagagggtaagatgcccatctcgcaagccttc
cagcctccacccaccattgtccctactcctacaggcggtgttcctcaacatatgcctgga
aacgcagccggaacgaacgtctccaaccacttgaaggtccagcttcttgtccgcgcgtat
caggctcgtggacaccataaggcaaagattgaccctctcggcattcgcggggaggctgat
tcttttggatacagcaagccaaaggaactcgagctgtcccactatggcttcactgagaag
gaccttgacgaggaatttgctcttggcccaggaatcctccctcgcttcgagactgagacc
cgcaagaagatgactcttcgtgagattattgatgcctgcgaaaagatctactgtggctct
ttcggcgtggaatacatccacattcctgaccgcgttccttgtgactggatccgtgaccgt
attgaaattcctcagccatacaagtactctgtcgatgagaagcgtcgcattctggaccgt
cttatctggagttccagcttcgaagcctttttggccaccaaattccccaatgacaagcgc
ttcggtctggaaggttgtgagaccctggtacccggcatgaaggcattgattgaccgaagt
gtcgactacggtgtcaaggatattgtcatcggtatgcctcaccgtggtcgattgaacgtc
ctcagcaatgtcgtccgtaagcccaatgaatctatcttcagtgagttcagcggtagcgcc
gaaccatctgatgagggctcaggtgatgtcaagtaccatcttggtatgaacttcgagcgc
ccaaccccgtctggaaagcgtgttcagctttcgctcgttgccaatccctctcatttggaa
gccgaagacccagttgtccttggaaagactcgctccatccagcactacaataacgacgaa
aaagaattcaacactgccatgggtgtccttcttcacggtgatgccgcattcgctgcccag
ggtatcgtttatgagaccatgggcttccattcgctacctgcctattccactggaggaacc
atccatatcgttgttaacaaccagatcggtttcaccactgacccccgttttgcccgatcc
accccttattgctctgatatcgccaaggccatcgatgctccagtcttccatgtgaacggt
gatgatgtcgaagctcttaaccacgtctgccagttggccgccgactggcgtgcccagttc
aagagtgatgttgtcattgacatcgtttgctaccgtaagcaaggccacaacgaaaccgat
cagcccgcctttacccagcctcttatgtacaagcgcattgcctcccagcagagccagatt
gataagtacgttgagaagctactaaaggagaagaccttcaccaaggaggatattgatgaa
cacaagaaatgggtctggggaatgctcaacgacagcttcgagcgcagcaaagactacacc
ccaaccagtcgagagtggctcacttccgcctggaacggattcaagacccccaaggagctt
gccactgaggtcctcggtcaccctcctaccggcgttgaagcagagaccctccagatgatt
ggtgctaagcttggaagcattcctgagaactttactccacaccgcaacctaaagcgtatc
ttggccaaccgggagaaatccatcaaggagggccaaaatatcgactggtccactgctgaa
gctcttgctttcggtaccttgtgtaaggagggccaccacgtccgcgtttctggccaggat
gttgagcgtggcacgttctctcagcgtcacgccgtcctccacgaccaagagaacgagagc
acatacactgctctccagcacatcagccccgaccaaggatcctttgtcatttccaactcc
tccctcagtgaatatggagctctcggtttcgaatacggttactcgctaacctctcctaac
gctcttgtcatgtgggaagctcagttcggtgacttcgccaacaacgcccaatgcatcatt
gatcagttcattgcctccggtgaatcgaaatgggttcagcgatctggtctcgtcatgtct
ttgccccatggatatgatggccagggccctgagcactcttccggcagactggaacgttac
ctccagctttgcaacgaggatcctcgcgtttacccagccgccgacaagattgacagacaa
catcaggactgcaacatgcagattgcctacatgacctcccccgccaacttgttccacatc
ctccgtcgacagatcaaccgtcaattcagaaaaccattgatcattttcttctcgaaatcc
cttctccgtcacccaagctgccgatcctccatcgaggagttcactggcgattcccatttc
cgctggattattcccgatgaccaacatggcaaacagattgatgagcctgagaaaatcgag
cgcgtgattatgtgctccggtcaagtttgggctgccctcaccaagcaccgtgaggccaac
ggtatcaggaacaccgccatcacccgtatcgaacaaatgcaccccttcccctggcaacag
ctgaaggagaacctcgacagctaccccaatgccaaggacattgtcttctgtcaagaggag
cctctcaacgccggaagctggagctacatgcaaccccgcattgagacccttctcaacgag
actgtccaccacaacaggcgccatgtcctgtacgccggtcgtaacccaagcgctagtgtg
gccactggcttgaagagcagtcacatcaaggaagagcaagatctattgcacgacgctttc
accgtacaccaggaaaagctcaagggcgagtag

DBGET integrated database retrieval system