KEGG   Alcanivorax borkumensis: ABO_1005
Entry
ABO_1005          CDS       T00380                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
abo  Alcanivorax borkumensis
Brite
KEGG Orthology (KO) [BR:abo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:abo03009]
    ABO_1005
Enzymes [BR:abo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     ABO_1005
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     ABO_1005
Ribosome biogenesis [BR:abo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABO_1005
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Spermine_synth
Other DBs
NCBI-ProteinID: CAL16453
UniProt: Q0VQU5
LinkDB
Position
1142748..1144862
AA seq 704 aa
MEFVATCMPGLADLLSDELGSLGISVTETGRAHVSFSGGVADALKVCLWSRLSERVLLHL
ATLGVTPDIAPEKLAASQDWLSLVGNNAPVHLHIEHGAEVRGDNRISAKRFIHALPEQFA
ISREPKGSCCIRARLDLNEAHLWLDLAGEPLHRRGYRLAGGRAPLRETLAAAILWAVGWG
KEGRHSALIDPFCGSGTLVIEAALIAAGRAAGAQRQHYGFQQWRGCRRQLWLDAQKEAGE
SGKRPVPAVSLKGFDSEASTLQLALQNAERAGVRNAIHFERRELGALRRRDFVDNGIVVG
NPPWGERLEEKPQAGWLHYALGRILSVRAPGYQALLLGADAEVMDRSGMNLEQQWRLKNG
PFNNFIRLYSPRKQTPANVVKVADDSAFNVPEGAQPLLNRLRKNGKHLRRWLEREDIQCY
RLYDRDLPEFNVAVDIYADQVLVQEFKAPKTIDPEKAKERRDWAVTAVRAALGVHREQVH
LRTREKQKGNQQYQKLDAQGQYRVVREGQSQLLINLQDYLDTGLFLDHRPTRLRIAEEAS
GKRFLNLFAYTGSATVHAAVGGAKRTVTVDSSKRYLDWAACNLAANGFSTDQHELARADT
MRWLDECKEQFDLVFCDPPTFSNNKSRSDFVVEEHHGDLIRKIMRCLEPGGVLYFSCNYR
RFQMDESISKWYAVEDISRWSIPEDFRRNEKIHYCYAIRHVEDA
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggaatttgtggccacctgcatgccaggtctggcagatctgctcagcgacgaactaggc
tcactgggcatatccgtaacagaaaccgggcgtgcgcatgtcagtttctccgggggcgtg
gcggatgctctgaaggtgtgcctctggtcccgtttgtccgagcgggtgctgctgcatctg
gccacgttgggtgtaacaccggatattgcaccggaaaagttggcggctagccaggattgg
ctatctttggtggggaacaatgcaccggtacatctgcatattgagcacggcgctgaagtg
cgtggtgataatcggatcagtgccaaacggtttattcatgcattaccggagcagtttgcc
atctcccgtgagccgaaaggcagttgctgtattcgtgcccggctggatttgaatgaggca
catctgtggttggatctggccggcgagcctttgcatcgccgtggatatcgcctcgcaggc
ggtcgtgcgccgctacgcgaaaccttggctgcagccatattatgggctgtagggtggggc
aaggaaggtcgtcattccgcgctgatcgatccgttttgcggtagtggtaccctggtgatt
gaagcggcgctgatagcagcaggccgcgccgcaggtgcccagcgtcagcactatggcttt
cagcagtggcgtggttgtcggcgccaattgtggttggatgcccagaaggaagcaggtgag
agtggtaagcggccagtgccagccgtatcgctgaaagggtttgattctgaagcgagcaca
ttgcaattggctttgcagaacgcagagcgcgccggagtgcgtaacgcaattcattttgag
cgccgggaactgggtgctctgcggcgtcgagattttgttgataacggtattgtggtgggt
aacccgccttggggtgagcgcctggaggaaaaaccacaagcgggctggctgcattatgcg
ctgggtcgtattttgtcggttcgagcgccgggctaccaggcattgttgctgggtgcggat
gcggaagtcatggaccgctccgggatgaatttggaacagcaatggcgcctgaaaaatggc
ccgttcaataactttatccgtctttattcgccccgtaagcagacgccagccaatgtggtg
aaagttgctgatgatagtgcgttcaacgtgcccgagggcgcgcaacccttattaaatcgg
ctgcgtaaaaatggcaaacacctgcgccgttggctggagcgggaggacattcagtgctac
cggctgtatgaccgcgatttgccagaattcaatgtggccgtggatatctatgcggatcag
gtgttggtgcaggagttcaaggcacctaaaaccattgatccggaaaaagcgaaagagcgc
cgtgattgggcggtgacagcggtgcgagcggccttaggtgttcaccgtgagcaggtgcac
ctgcgcacccgtgaaaagcagaaggggaatcagcaatatcaaaagctggatgctcaggga
caataccgggttgtgcgtgaagggcaatcgcagttgttgattaatttgcaggattacttg
gataccgggctatttctcgatcaccggcccacgcgtttgcgtatcgctgaagaggccagt
ggtaagcgcttccttaacctgtttgcgtacacggggtctgccacggtgcatgctgctgtg
ggtggcgcaaagcgcaccgttacggtggattcctccaagcggtatctggattgggcagcc
tgcaacctggccgctaacggtttctccaccgatcagcatgaattggctcgggccgacacc
atgcgttggctggatgagtgtaaggagcagtttgatctggtgttctgcgatccgcccact
ttttccaataataagtcacggagtgactttgtggtggaagagcatcacggtgatttgatt
cgcaagattatgcgctgcttggaaccgggtggggtgctgtatttctcctgtaattaccgt
cgcttccaaatggatgaaagcatcagcaagtggtacgcggtagaggatatctcacgttgg
agtatcccggaggatttccgccgcaatgaaaaaatccattattgctatgccattcgtcat
gtggaggatgcatga

DBGET integrated database retrieval system