KEGG   Anolis carolinensis (green anole): 100558337
Entry
100558337         CDS       T01608                                 

Gene name
rock1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04270  Vascular smooth muscle contraction
acs04350  TGF-beta signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100558337 (rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100558337 (rock1)
   04530 Tight junction
    100558337 (rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100558337 (rock1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100558337 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100558337 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100558337 (rock1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100558337 (rock1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100558337 (rock1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100558337 (rock1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH KASH_CCD Pkinase_C
Other DBs
NCBI-GeneID: 100558337
NCBI-ProteinID: XP_003219700
Ensembl: ENSACAG00000007990
UniProt: G1KHH5
LinkDB
Position
4
AA seq 1357 aa
MSAGESFESRFEKIGMMIKDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDTFLNKYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLSFP
DDNDISKDAKNLICGFLTDREVRLGRNGVEEIKRHPFFKNDQWSWENLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNHQYLSSCTANSNDNRAST
NVDKSLLEPLQKTIYQLEEQLHNEMQLKDEMEEKFRTSNIKLDKIMKELDEEANQRKNLE
LTVTQVEKENMLLQHRISEYQRKCEQENEKRRNVENEVSTLKDQLEDFKKISQHSHITNE
KITQLQKQLEEANDLLRTESDTAARLRKSHTEMSKSVSQFESLNREMQERCRILESSKLQ
LEKDFYQLQAALEVERRDRSHGSEIIGEMQARITSLQEEIKSIKNNLERVEEERKQAQDM
LNHSEKEKNNLEIDLNYKLKMLQQRLDQEINEHNINKARLTDKHQSIEEAKSVAMCEIEK
KVKEERAAREKAENRIVQIEKQCSMLDFDLKQSQQKLEHLNEQKERLEDEVKNLTLQLEH
EINKRVMTQNELKMHAIEADSLKGSEKQLKQEINTLLEAKRLAEFELAQLAKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNKETQKKIQELQNEKETLAAQLDLAETK
AESEQLARALLEEQYFELSQESKKAASRHRQEIADKDGIVSRLEETNNTLTKDVAFLTKE
NSELNEKVKKLEEDYKLKTEEEISIIRMQYEKNLNNERTLKTQAVNKLAEIMNRKDFKLD
RKKVNMQDFKKKEKENRKLQLDLNQEKEKFNHVVIKYQKELNEMQAQLVEESTYRNELQM
QLDSKESDIEQLRSKILDLQQGMDSTSVASLPADETDGNIVESRMEGWLSIPNKGNIKRH
GWKKQYVVVSSRKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEVEPVQPAEKTNFLNHKGHEFIPTLYHFPANCEACAKPLWHVFKPP
PAVECRRCHVKCHKDHLDKKEELIAPCKVSYDVTSARDMLLLATCQEDQKKWVTHLVKKI
PKTPPSSFVRASPRTLSTRSSANQSFRKVKNASGKAS
NT seq 4074 nt   +upstreamnt  +downstreamnt
atgtcggcaggagagagctttgagtcccggtttgaaaaaatcggcatgatgatcaaggat
cccaaatcggaagtgaactcggactgcttattggatggattagatgccctggtatatgat
ttggattttcccgctttaaggaaaaataaaaacatagacacctttttaaacaaatataaa
gacacaataaacaaaataagagatctccgtatgaaagctgaagattatgaagtggtgaaa
gttattggaagaggtgcatttggggaagtccaattggtaaggcataagtcatctcgaaag
gtctatgctatgaagctcctgagcaagtttgagatgataaaaagatcagattctgcattc
ttctgggaagaaagagacatcatggcatttgcaaatagcccttgggtagttcagttattt
tatgcattccaagatgatcgttatctttacatggtgatggaatacatgcctggtggggat
ctggtgaatttaatgagcaattatgatgttcctgagaaatgggcaagattctatactgca
gaggttgttcttgcattagatgcaattcattccatgggctttattcacagagacgtaaag
cctgataatatgctgctagataaatccggccatttaaaactagcagattttggtacctgt
atgaagatgaataaggaaggtatggtacgatgtgatacagctgttggaacacctgactat
atatctccagaagtattaaaatctcaaggtggtgatggttactatggacgagaatgtgac
tggtggtcagttggcgtctttttgtatgaaatgcttgtgggagatacccccttttatgca
gattcattggttggaacatatagtaaaattatgaaccataaaaattctctaagcttccct
gatgataatgatatttctaaagatgcaaaaaatcttatttgtggattcttaactgacagg
gaagttagattaggccgaaatggcgtggaagaaatcaagcgacacccatttttcaaaaat
gaccagtggtcatgggaaaatcttagagacactgttgcacctgttgtgcctgatttaagt
agtgatattgacactagtaactttgatgatttggaagaagacaaaggagaagaagaaaca
tttcctataccaaaagcatttgttggaaaccaattgccatttgtaggatttacttactac
agtaaccaccagtatttatccagttgcacagcaaattctaatgacaacagagcaagcact
aatgtagataaaagtttgctggaacctttgcaaaaaactatctatcaacttgaagaacag
ctacataatgaaatgcaactgaaagatgaaatggaagaaaaatttagaacatcaaacatt
aaactagacaagataatgaaggaactggatgaagaggccaaccagagaaaaaatttggaa
ttgacagttacacaggttgagaaagaaaatatgcttctgcagcaccgaataagcgaatat
caacgaaaatgtgaacaagagaatgagaaacgccgtaatgtagaaaatgaagtgtcaaca
ttaaaagatcagttggaggattttaaaaaaatcagccagcattcacatattacaaatgaa
aaaataacacagcttcaaaagcagcttgaagaggccaatgatttactgcggacagagtcg
gatactgcagcaaggttgagaaaaagtcatacagaaatgagcaaatcagtaagtcagttc
gaatccctaaatagggaaatgcaagagagatgcagaatcctggagagctcaaaattacaa
ttggaaaaggatttttatcaactgcaagcagcactggaagtagaacgaagggataggagc
catggatctgaaattattggagagatgcaagctcggattacctcattgcaagaagaaatc
aaaagtataaagaacaatcttgaaagagtagaagaagaaagaaaacaggcccaggacatg
cttaatcattctgaaaaggaaaagaataatttagaaatagatctaaactacaaacttaaa
atgttacaacagcgtttggatcaagaaataaatgagcataatataaataaagcccgattg
actgacaaacatcagtcaatagaagaggcgaaatcagttgcaatgtgtgaaattgaaaaa
aaggtgaaagaagaaagagcagcaagagaaaaggcagaaaatcgaatagtacagattgaa
aagcaatgttccatgctagattttgacttgaaacagtctcagcagaaactggaacacctg
aatgagcaaaaagagaggctggaagatgaggttaagaatctgacacttcagcttgaacat
gagataaataaaagagtaatgacacagaatgaactgaagatgcatgctattgaggcggat
agcttaaagggatcagagaagcagcttaagcaggagatcaacacattgctggaagcaaag
agattagcagaatttgagctggctcagttggcaaagcagtacagagggaatgaaggccag
atgcgtgaactacaagatcaacttgaagctgaacagtatttttctacactatacaaaact
caagttaaagaacttaaagaagaaattgaggaaaagaataaagaaacccagaagaagata
caagaattacaaaatgaaaaggaaaccctcgctgcacagttagatctggctgaaacaaaa
gctgaatctgagcagttggctcgagctctccttgaagagcagtattttgaactctctcag
gagagtaagaaggcagcatcacgacatagacaagaaatcgctgataaggacggtattgtc
agccggcttgaagaaacaaataatacattgaccaaagatgtggcatttttaacaaaagaa
aattctgagctcaatgaaaaagttaagaaacttgaagaagattataaattgaagacagaa
gaagaaatcagcatcatcagaatgcaatatgaaaagaacctgaacaatgaaagaaccctt
aaaacacaggccgtcaacaaattggctgagataatgaatcggaaagattttaaactagat
agaaagaaagtgaacatgcaagacttcaagaaaaaggagaaggaaaaccggaagttacag
ttggaccttaaccaagagaaggagaaatttaatcatgtagtaataaaataccagaaagag
cttaatgaaatgcaagcgcaacttgtggaagaatctacatataggaatgaacttcagatg
cagctggatagtaaggagagtgatatagagcaattgcgcagtaaaattttggacctacag
caaggcatggattctaccagtgttgccagcctcccagccgatgaaactgatggaaatatt
gtggaatcaagaatggagggctggctttcaataccaaacaaaggaaatataaagcgtcat
gggtggaagaagcagtatgttgtggtaagcagcaggaagatcttgttctataatgacgaa
caagataaagaacaatctaacccatccatggtattagatatagacaaattgtttcatgtt
agacctgtgacacagggagatgtatatagagctgaaacagaagaaattcctaaaatattt
cagattctgtatgccaatgagggtgaatgcagaaaagatttggaggtagaacctgtacag
ccagcagaaaagacaaattttctgaaccataaaggtcatgaatttattccaacattatac
cactttccggccaactgtgaggcctgtgccaagcccctctggcatgtctttaagccaccc
cctgcagtggaatgtcggagatgccatgttaagtgccataaagatcacttggacaaaaaa
gaggaattaattgcaccatgtaaagtgagttacgatgtaacctcagcaagagatatgttg
ttattggcaacctgtcaagaagatcaaaagaaatgggttactcatttagtaaagaagatc
cctaaaacgccaccatcgagttttgtccgtgcctcacccagaactctttctacgaggtcc
tcagcaaatcagtcattcagaaaagttaagaatgcttctggaaaagctagttaa

KEGG   Anolis carolinensis (green anole): 100562729
Entry
100562729         CDS       T01608                                 

Gene name
rock2
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04270  Vascular smooth muscle contraction
acs04310  Wnt signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100562729 (rock2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100562729 (rock2)
   04530 Tight junction
    100562729 (rock2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100562729 (rock2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100562729 (rock2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100562729 (rock2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100562729 (rock2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100562729 (rock2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100562729 (rock2)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100562729 (rock2)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100562729 (rock2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Cortex-I_coil HR1 APH
Other DBs
NCBI-GeneID: 100562729
NCBI-ProteinID: XP_008115636
Ensembl: ENSACAG00000000198
LinkDB
Position
1
AA seq 1517 aa
MNHRPPQQPAASAGKMPAPQAPAVGEDALLPGRRRKLEAMIRDPRSPVNLESLLDSLNSL
VLDLDYPALRKNKNIDNFLNRYEKVVGKIRGLQMKAEDYEVVKVIGRGAFGEVQLVRHKV
TQKAYAMKLLSKFEMLKRSDSAFFWEERDIMAFANSPWVVQLFSAFQDDRYLYMVMEYMP
GGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKYGHLKLADF
GTCMKMDETGMVRCDTAVGTPDYISPEVLRSQGGDGYYGRECDWWSVGVFLFEMLVGDTP
FYADSLVGTYSKIMDHKNSLHFPEDVEISKHAKDLICAFLTDREVRLGRNGVEEIKSHLF
FKNDQWDWGNIRDTAAPVVPELSSDIDSSNFEDVEDDKGDVETFPVPKAFVGNQLPFIGF
TYFRDNLLLSDFSEVSREAEPCNNNGARKNELRKNEDNEEFAQFQEKINKLEDQLHNEVQ
TKEELEQKCRTINNRLEKIIKELDEEATSRKNLESALRQLEREKALLQHKNAEYQRKAEH
EADKKRNLENDVNSLKDQLEDLKKRNHNSQISNEKIIQLQRQLDEANVLLRTESDTAARL
RKNQTESAKQIQQLEANNRDLQDKNCALENTKLRLEKDFLNLQSVLESERRDRNHGSEII
SDLQGRISSLEEEVKNGKIALAKMETEKRQLQDMFTDLEKEKSNMEIDMTYKLKVMQQNL
EQEEVEHKATKARLADKNKIYKSIEEAKSEAMKEMEKKLSEERVSKQKVENCLLEVEKRC
SMLDCDLKQSQQKINELLKQKDKLNEDVENLTLKIEQETQKRSLTQNDLKMQTQHVNALK
MTEKQLKQENNHLLEIKLSLEKQNNELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVR
ELKEECEEKTKHCKEMQQKIQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEK
EKIMKELEIKEMMARHKQELSEKDATIGSLEEANRTLTSDVANLANEKEELNNKLKEVQE
RIVRINEDENDIDLLKTQYEKQLAYERTMKTQAVNKLAEVMNRKNPIQRGADTDVRRKEK
ENRKLHMELKSEREKLTQMMIKYQREINEMQAQIADESQIRIELQMALDSKDSDIEQLRS
QLQSIHIGLDSTSIGCGPGEAEADDGFPVRITQSHTSESMSFTYEHSSTSVSIATKPSSS
RVFLSSDSDSEEEPLPPAQVPSEPDNPESRLEGWLSLPARNNTKKFGWVRKYVVVSSKKV
LFYHSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADSKDIPRIFQILYDNEGESKKEL
EFQAELAGDKSNYTCHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHK
DHMDKKEEIIAPCKVNYDISTAKNLLLLANSMEDQQKWVSRLGKRIPKKPPAPDPFARSS
PRTSMKVQPNQSIRRPSKQLPPNKKEGFPPRLIEMACRDWDWSFDDIDFDIEFNIDDAGN
DNDLDDSDDDNVFVLKS
NT seq 4554 nt   +upstreamnt  +downstreamnt
atgaaccaccggcccccgcagcagccggcggcctcggcggggaaaatgcccgccccgcaa
gcgcctgccgtcggggaggacgcgctgctcccgggccggcggaggaagctggaggccatg
atccgggacccccgctcgccggtcaatttggaaagtttgctggatagtttgaactcttta
gttcttgatctggattatccagcactgaggaagaacaagaatattgacaacttcttaaac
agatatgagaaagttgtcggaaagatccgtggtctccagatgaaagcagaagattatgaa
gttgttaaagtgattggaagaggtgcatttggtgaagtacagttggttcgtcataaagta
acacagaaagcttacgccatgaaacttcttagtaaatttgaaatgctcaaaagatcagac
tcagcctttttctgggaggagagagatattatggccttcgccaacagtccatgggtagtt
cagctttttagtgcctttcaagatgaccgatacctatacatggtaatggaatacatgcca
ggtggagatcttgtcaacctcatgagcaattatgatgtgcctgagaagtgggccaaattt
tacactgctgaagttgttcttgcccttgatgcaattcattccatgggcttgatacacaga
gatgtgaaacctgacaacatgcttttggataaatatggacatctgaagcttgcagatttt
ggtacctgtatgaaaatggatgaaacaggaatggtgcgttgtgatacagctgttggaaca
ccagactacatatcacccgaagtattgaggtcacaaggtggtgatggttattatggaagg
gaatgtgactggtggtctgtaggagtctttctgtttgagatgctagttggagatactcca
ttttatgctgattcattggttggaacatacagtaaaataatggatcacaaaaattcattg
cactttccagaagatgtggaaatctcaaagcatgcaaaggatcttatctgtgccttttta
acagacagggaggtgcgtctcggaaggaatggagttgaagaaattaaatcgcatctgttc
tttaaaaatgatcaatgggattggggtaacattcgagacactgcagcaccagttgtccct
gagctgagtagtgacatagatagcagcaattttgaagatgttgaagatgataaaggagat
gtcgaaacttttcccgtccctaaagccttcgttggaaaccagttgcctttcataggattt
acttactttagagacaacctgttgctaagtgacttttctgaggtctctagagaagccgaa
ccctgcaataacaatggagcaaggaaaaatgaactaaggaaaaatgaggacaacgaagag
tttgcacagtttcaggaaaaaataaacaaattagaagatcagcttcataatgaagtacag
accaaagaggagcttgagcaaaaatgcagaactattaataatcgcctagagaagataata
aaggagttggatgaagaggcaacctcacgaaaaaatctagaatctgccttaagacaattg
gaaagggagaaagctcttcttcagcacaaaaatgcagaataccagcggaaagcagaacac
gaagcagataaaaagcgcaatctggaaaatgatgttaacagtttgaaggaccagctagaa
gatttgaaaaagagaaatcacaactctcaaatatcaaatgaaaaaatcattcagctacaa
agacagctggatgaagccaatgttctgctgcgcacagagtctgatacagcagccaggctg
aggaagaaccaaactgaaagtgcaaagcagatccaacagctggaagctaataaccgagat
ctgcaagataaaaactgtgccctggagaatactaagcttaggcttgagaaggacttcctc
aatctgcagtcagttctagaatcagaaagaagagatcggaatcacgggtcagagattatc
agtgatctacaaggccgcatatctagtttagaagaagaagtaaaaaatggaaagattgca
ttagctaaaatggagaccgagaaaaggcaattacaggacatgttcacagatctggaaaag
gagaagagcaacatggaaattgacatgacatacaagctcaaagtcatgcagcagaacttg
gaacaagaagaggttgaacacaaggcaacaaaagcccggctagcagacaaaaacaaaatc
tataaatccattgaggaagccaaatctgaggccatgaaagaaatggagaagaagctttca
gaggagagagtttccaaacaaaaagtggaaaactgcttgttggaagttgaaaagcgatgt
tcgatgttggactgtgatctgaaacaatcgcagcagaaaataaatgaacttcttaagcag
aaagataaactaaacgaggatgttgaaaacttgacattgaaaatagaacaggaaacacaa
aaacgtagcctcacacaaaacgaccttaagatgcaaacccagcatgtcaatgcattgaaa
atgacagagaagcagctcaaacaggagaataaccatcttttggaaatcaaattgagtttg
gaaaagcaaaataatgaacttcgcaaagaacgtcaggatgctgacggccagatgaaagaa
cttcaagaccaacttgaggcagaacagtatttttcaacgctgtataaaacccaagttcgg
gaacttaaggaagaatgtgaagaaaagaccaaacattgtaaagaaatgcagcagaagata
caagaattgcaagacgagagggattctttggcagcccaacttgaaattaccttaaccaaa
gcagattcggaacagcttgctcgttctattgctgaggagcaatattcggatttggaaaaa
gaaaagatcatgaaagagctggagattaaagaaatgatggccaggcacaaacaagagctt
tctgaaaaagatgccaccataggatcattggaagaagcaaataggactttaacaagtgat
gtggcaaatctggcaaatgaaaaagaagagctcaataataaacttaaagaagtccaagaa
agaattgttcgtattaatgaggatgaaaatgatatagatctgcttaagactcagtatgag
aaacagttggcttatgaaagaaccatgaagacccaggctgtaaacaagctggctgaagtc
atgaatcgcaagaacccaatccaacgaggagctgacactgatgtcagaaggaaagaaaaa
gagaatcgtaaactgcacatggaactcaagtctgaacgtgaaaagttaactcagatgatg
atcaaatatcagagggagatcaatgaaatgcaagcgcaaatagccgatgagagccagata
agaatcgaactgcagatggctctggacagcaaagatagtgacatcgagcagcttcgctct
caacttcaatcaatacacattggtttagacagcactagtataggctgtggcccaggggaa
gcagaggcggatgatggatttccggtccgtatcactcagtcccacacttcggagtctatg
tcctttacctacgaacactcttctacttctgtcagtattgccactaagccctctagttct
cgagtgtttctcagctctgattctgactcagaggaagaaccgttgcctcctgcacaagtc
ccttcagagcctgataatccagagtcaagattggagggttggctatcgttgcctgccaga
aacaacacaaagaaatttggatgggtcagaaagtatgtggttgttagcagcaagaaggtc
ctgttctaccatagtgagcaagataaagaacaatcaaacccttacatggtcttagacatt
gacaaactatttcatgtccggcctgtcacgcaaacagatgtatacagagcggattcaaag
gatattcccaggattttccagatcctatatgataacgaaggggaaagcaagaaggagctg
gaattccaagcggaattagcaggagataaatccaactatacttgccacaagggacacgaa
ttcatacctacactgtatcacttcccaaccaactgtgaggcctgtatgaagcccttgtgg
cacatgtttaagcctcctcctgccctggagtgccgtcgctgccacatcaaatgccataaa
gatcacatggataaaaaagaagagatcatagcaccttgcaaagtgaattatgatatatca
actgcaaagaacctactgctgttagccaattccatggaggatcaacagaaatgggtgagc
cgcctggggaaaaggatccccaagaaacccccggcaccagatccatttgcacgctcttca
ccaagaacttccatgaaggtacagccaaaccagtctattagacggccaagcaaacagctt
cctccaaataaaaaggaaggcttccctccaagattgattgagatggcatgtagagactgg
gattggtcatttgatgatattgattttgatattgagtttaatattgatgatgctgggaac
gataacgatcttgacgatagcgatgatgataacgtgtttgttctgaagagctaa

DBGET integrated database retrieval system