KEGG   Anolis carolinensis (green anole): 100558412
Entry
100558412         CDS       T01608                                 

Gene name
cdk6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100558412 (cdk6)
   04115 p53 signaling pathway
    100558412 (cdk6)
   04218 Cellular senescence
    100558412 (cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100558412 (cdk6)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100558412 (cdk6)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100558412 (cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 FTA2 Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 100558412
NCBI-ProteinID: XP_003222154
Ensembl: ENSACAG00000015273
LinkDB
Position
6
AA seq 326 aa
MDKDNMAHADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTERETKLTLVFEHVDQDLTTYLNKVPEPGVPSE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRALFRGNSDVDQLGKIFDVIGLPDE
EDWPSDVALPRNAFTSRTLQPIERFVTDIDELGKDFLLKCLTFNPTKRISAYDALSHPYF
HDLERCKENMDSDMSSSQNSTEMNTP
NT seq 981 nt   +upstreamnt  +downstreamnt
atggataaggacaatatggcccatgcagaccaacaatatgaatgtgtggctgagattggt
gaaggagcctatggaaaggtgttcaaggcccgggacttgaagaacggcggacgcttcgtg
gccttgaagagggtgcgggtgcaaacaagtgaggagggaatgccgctttccaccatacgg
gaggtggctgtcttgaggcatctggagacctttgagcaccccaacgtggtcaggttgttt
gatgtatgtacagtgtcccgaacagaaagagaaacgaagttaacattggtgtttgagcat
gttgatcaagatttgaccacttacttgaataaagttccagagcctggagttcctagcgaa
actataaaggacatgatgtttcagctgctgcgagggcttgattttctgcattcccataga
gtcgtccaccgtgatctcaaaccacaaaatattttagtaaccagcaatgggcagataaaa
ttagctgactttggccttgcacggatctacagttttcaaatggcccttacctcagtggtt
gtcactctatggtacagagctccagaggttttgcttcagtctagttatgccacaccagta
gatctttggagtgttggctgtatatttgcagaaatgttccgtagaagagcactttttcgt
ggaaactcagatgttgatcaactaggaaaaatctttgatgtaattgggcttcctgatgaa
gaggactggccaagtgatgttgctctcccaaggaatgctttcacttctcggactcttcag
cctattgaacgttttgtaacagatattgatgaactaggcaaagacttcctacttaaatgc
ttgacattcaatcccacaaagagaatatctgcttatgatgcattatctcacccttatttt
catgatctggagagatgcaaagagaatatggattcggatatgtcatccagtcagaactcc
actgagatgaatacaccataa

KEGG   Anolis carolinensis (green anole): 100559515
Entry
100559515         CDS       T01608                                 

Gene name
cdk4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04218  Cellular senescence
acs04530  Tight junction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100559515 (cdk4)
   04115 p53 signaling pathway
    100559515 (cdk4)
   04218 Cellular senescence
    100559515 (cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100559515 (cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100559515 (cdk4)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100559515 (cdk4)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100559515 (cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 POT1PC Kinase-like
Other DBs
NCBI-GeneID: 100559515
NCBI-ProteinID: XP_003216735
Ensembl: ENSACAG00000013219
UniProt: G1KNG9
LinkDB
Position
2
AA seq 303 aa
MAMGRCEQYEPVAEIGIGAYGTVFKARDLQSGKFVALKNVRFQNSENGLPHSTVREVALL
KRLENFDHPNVVRLMDVCTTTRTERETKVTLVFEHVDQDLKAFLEKTPPPGLPAEMIKDM
MHQFLSGLDFLHTNCIVHRDLKPENILVTSSGQVKLADFGLARVYSCQMALTPLVVTLWY
RAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPL
DVSLPRCAFAPCSPQPIERFVPEIDTLGIQLLLEMLTFNPLKRISAFQALHHQYFQDMSA
GEG
NT seq 912 nt   +upstreamnt  +downstreamnt
atggccatggggagatgcgaacagtatgaacctgtggccgaaatcggcattggggcttat
ggcactgtcttcaaggcccgtgacctgcaaagtggcaagtttgtggcccttaagaatgtg
cgattccagaacagcgagaatgggttgccgcactccacggtccgtgaagtggccctgctg
aaacgcctggagaactttgaccaccccaacgttgtgcggctaatggacgtttgcacaaca
acacggacagagcgtgagaccaaagtaacattggtctttgagcatgtggatcaggatctg
aaagcatttttggagaaaactccgcctcctggcttaccagcagagatgatcaaggatatg
atgcatcagttcttgagtggcttggatttcctgcatacaaactgcattgttcatcgtgac
ctcaagccagaaaatatcttggtgaccagttctggtcaagtcaagttggctgactttggc
ctggctcgcgtctacagctgtcagatggccctgacacctctggtggtcactctctggtac
cgggctccagaagtgctgctccagtcagcttatgccacccctgtggacctgtggagtgtg
gggtgcatctttgcagagatgtttcgaaggaagcctctcttctgtggcaactccgaagct
gatcagctgggcaagatctttgatttgattgggctcccacctgaggaggattggcccctg
gacgtttctctgccacgctgtgcctttgctccctgctccccacagcctattgagaggttt
gtgccagaaatagacaccctggggatccagctgcttttggaaatgctgacattcaatccc
ttgaaacgcatctctgctttccaagcactgcatcatcagtactttcaggacatgagcgca
ggtgaagggtag

DBGET integrated database retrieval system