KEGG   Actinoalloteichus sp. GBA129-24: UA75_11090Help
Entry
UA75_11090        CDS       T04619                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) synthase
  KO
K05551  minimal PKS ketosynthase (KS/KS alpha) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti01056  Biosynthesis of type II polyketide backbone
acti01100  Metabolic pathways
acti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    UA75_11090
   00253 Tetracycline biosynthesis
    UA75_11090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acti01004]
    UA75_11090
   01008 Polyketide biosynthesis proteins [BR:acti01008]
    UA75_11090
Enzymes [BR:acti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     UA75_11090
    2.3.1.260  tetracycline polyketide synthase
     UA75_11090
    2.3.1.-  
     UA75_11090
Lipid biosynthesis proteins [BR:acti01004]
 Polyketide synthase
  Component type
   UA75_11090
Polyketide biosynthesis proteins [BR:acti01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     UA75_11090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N DNA_processg_A
Motif
Other DBs
NCBI-ProteinID: APU20230
UniProt: A0A1L7F5W0
LinkDB All DBs
Position
2465584..2466852
Genome map
AA seq 422 aa AA seqDB search
MNRKVVVTGIGVVAPGGVGREAFWDLLTAGRTATRTISMFDPSKFRSQIAAEADFDATAA
GLTAREIRRMDRAAQFAVVSAREALADSGVDLTADPGRVGVSVGSAVGCTMGLEEEYAVL
SDNGRNWLVDHSYGVPHLYGYMVPSTLAVEVARDVAAEGPVSLISTGCTSGLDAVGHGAA
LIREGSADIVIAGATDAPLSPITAACFDAIKATSPRNDDAEHASRPFDATRNGFVLGEGS
AIMVLEDAESARRRGAHVYAELVGFAGRSNAFHMTGLKPDGREMAEAIRVALDQARINPS
DVDYINAHGSGTKQNDRHETAAFKRSLGERAYEVPVSSIKSMVGHSLGAIGSIEVAACAL
ALDRQVVPPTANLENSDPECDLDYVPKIARDHDMDVVLSVGSGFGGFQSAMLLARPGAVA
PL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgcaaggtcgtcgtcaccggcatcggggtcgtcgcgccaggcggggtcggccga
gaggccttctgggacctgctcaccgccgggcgcaccgccacccggacgatcagcatgttc
gacccgtcgaagttccgctcgcagatcgccgccgaggccgacttcgacgcgaccgcggcg
ggcctgaccgcccgtgagatccgccggatggaccgggccgcacagttcgcggtggtcagc
gccagggaggcgttggccgacagcggagtcgatctgacggcggaccccggccgcgtcgga
gtgagcgtcggtagcgcggtcggctgcacgatgggcctggaggaggagtacgcggtcctc
tccgacaacgggcggaactggctggtcgaccacagctacggggtgccgcacctctacggc
tacatggtgccgagcaccttggcggtcgaggtggccagggacgtggcggccgaggggccg
gtcagtctgatctccaccggctgcacgtccgggctcgacgcggtcggtcatggagcggcg
ctcatcagggagggcagcgccgacatcgtgatcgccggtgccaccgacgcgccgctctcc
ccgatcacggcagcctgcttcgacgccatcaaggccacctcgccccgcaacgacgatgcg
gagcacgcctcccggcccttcgacgccacgcgcaacggattcgtcctcggcgaaggcagc
gcgatcatggtgctggaggacgccgagtccgctcggcgacggggcgcgcacgtctatgcc
gagctggtcggcttcgccgggcggagcaacgccttccacatgacgggcctcaagcccgac
ggcagggagatggccgaggcgatccgcgtcgcgctcgaccaggccaggatcaacccctcc
gacgtcgactacatcaacgcgcacggctccgggaccaagcagaacgaccgccacgagacg
gccgccttcaaacgcagcctcggcgagcgtgcctatgaggtgcccgtcagctccatcaag
tcgatggtcggccactcgctcggggccatcggctcgatcgaggtcgccgcctgcgcactg
gctctcgatcggcaggtcgtgccgccgacggccaacctggagaactccgacccggagtgc
gacctggactacgtgccgaagatcgctcgggaccacgacatggacgtcgtgctcagcgtc
ggcagcggtttcggcggcttccagagcgccatgctcctggcccggccgggagcggtggct
ccgctgtaa

DBGET integrated database retrieval system