KEGG   Azotobacter chroococcum: Achr_21940Help
Entry
Achr_21940        CDS       T03640                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase (Precursor)
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
acx  Azotobacter chroococcum
Pathway
acx00500  Starch and sucrose metabolism
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Achr_21940
Enzymes [BR:acx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Achr_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AJE21643
UniProt: A0A0C4WI87
LinkDB All DBs
Position
2447584..2450052
Genome map
AA seq 822 aa AA seqDB search
MQQPVRFRKTLLSVLIGALGISQVAMGADQVAPGAPGAAPFWSYSGKTGIGTSYEQYKDG
QYSPQAATGEVSKVWFSLAQGIVTETMFGLIHEAQLREMQLVIQGPDFLDLEAQDTDSEV
QYLSVDGEGRPTSLAYKIINRDKQGRYEIEKHVFTDPDANSLMMRVIFRSKEPGIQAYVH
VDPAIGNDGSGDSAFVDGQALYARDGEMTLVVKASRPLEQPTVGFAGISDGLTDLKDGKL
DNLYTSTGDAPGNVTMLARLPQTGNETTLDLVVGFGNDRQQADRAADATLARGYAKVLAH
YNGEGEAIGWQDYLASLSGLPAMYAQSTDNGKLLNVSALVLKAQEDKSNAGALIASLSNP
WGETVPADKGTTGYKAVWPRDFYQCAMALLALGDRETPKVAFEYLKKVQVTETTSLKQGD
TSAYIHEQKQDGKAENAGPGATGWFLQKTHVDGEIEWVGVQLDQTAMPIMLGWKLWQAGV
LDDAQIRHWYQTMLKPAAEFLVKGGQVKVGWNDWKVVPPQTQQERWEEQWGYSPSTTAAV
IAGLVAASELAGHAGDAEAAKSFLGAAKGYSDKLEATMFTQKGSLGDGRHYLRITQNDNP
NDGAPLLDNNSRPGLPEHQVLDAGFLELVRYGVRPATDPHIVGSLDELDSQELPENLKVK
YLFSYPGVEGEFPGWRRYGNDGYGESEISAINFPATEAPVLNSGLRGRVWPIFTGERGHY
ELARSKAQLPEGVEALNAEQLAKLKNTYVKAMELFANEGMMLPEQVWDGVGNNSRHNYVK
GEGTNTATPLAWSHAEYVKLVRSLTDQRVWDHYPVVSDKLAK
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagccagtaaggttccgtaaaactctgctgagcgtcctgatcggcgctctggga
atcagtcaggtcgcgatgggcgccgaccaggtggcgccgggtgcgccgggagcggcgccg
ttctggtcgtattcgggcaagaccggcatcggcacctcctacgagcagtacaaggacggc
cagtactcgccgcaagcggccaccggcgaagtctcgaaggtctggttctcgctggcccag
gggatcgtcaccgaaaccatgttcgggctgatccacgaagcccagctgcgcgaaatgcaa
ctggtgatccagggccccgacttcctggacctggaagcacaggacaccgacagcgaagtg
cagtatctgtcggtcgacggcgaaggccgccctacctcgctggcctacaagatcatcaac
cgcgacaagcagggccgctacgagatcgagaagcacgtcttcaccgatccggacgccaac
tcgctgatgatgcgggtcatcttccgcagcaaggagccgggcattcaggcctatgtgcac
gtcgatccggccatcggcaacgacggcagcggcgacagcgccttcgtcgacggacaggcg
ctgtacgcccgagacggcgagatgaccctggtggtcaaggccagccggcccctggaacag
cccaccgtcggtttcgccgggatctccgacggcctgaccgacctcaaggacggcaagctc
gacaacctgtacaccagcaccggggatgcgcccggtaacgtcaccatgctggcgcgcctg
ccccagacgggcaacgagaccaccctcgacctggtggtcggcttcggcaacgaccgccag
caggccgaccgggcggcggacgcgacgctggcccgcggctatgccaaggtgctggcccac
tacaacggcgagggcgaggcgatcggctggcaggactacctggcctcgctctccggcctg
ccggccatgtacgcgcagagcaccgacaacggcaagctgctcaacgtcagcgccctggtg
ctcaaggcgcaggaagacaagagcaacgccggggcgctgatcgcctccctgtccaacccc
tggggcgagacggtgccggcggacaaaggcaccaccggctacaaggcggtctggccgcgc
gacttctaccagtgcgcgatggcgctgctggcactcggcgaccgcgaaacgccgaaggtc
gccttcgaatacctgaagaaggtccaggtcaccgaaaccacctcgctcaagcagggcgac
acctcggcctacatccacgaacagaagcaggacggcaaggccgagaacgccggccccggc
gccaccggctggttcctgcagaagacccacgtcgatggcgagatcgaatgggtcggggtg
cagctcgaccagaccgccatgcccatcatgctgggctggaagctctggcaggccggcgtg
ctcgacgacgcccagatcaggcactggtaccagaccatgctcaagccggcggcggaattc
ctggtcaagggcggccaggtgaaggtcggctggaacgactggaaggtcgtcccgccgcag
acccagcaggagcgctgggaggagcaatggggctactcgccctcgaccaccgcggcggtc
atcgccggcttggtggccgcctccgaactcgccggccatgccggggatgccgaagcggcg
aagagcttcctgggcgccgcgaagggctactccgacaagctggaagcgaccatgttcacc
cagaagggcagcctgggcgatgggcgccattacctgcgcatcacccagaacgataacccc
aacgacggcgcccccctgctcgacaacaacagccggcccggcctgccggagcatcaggtg
ctcgatgccggcttcctggagctggtgcgctacggcgtgcgtcccgccaccgacccgcac
atcgtcggcagcctggacgagctcgacagccaggagctgcccgagaacctgaaggtcaag
tacctgttcagctatccgggggtcgagggcgaattccccggctggcgccgctacggcaac
gacggctacggcgagagcgaaatctccgccatcaacttcccggccaccgaggcgccggtg
ctcaactccgggctgcgcggccgcgtctggccgatcttcaccggcgagcgcggtcattac
gagctggcgcgcagcaaggcccagctgccggaaggcgtcgaggcgctgaatgccgagcaa
ctggcgaagctgaagaacacctacgtcaaggccatggagctgttcgccaacgagggcatg
atgctgccggaacaggtatgggacggcgtgggcaacaacagccgccacaattacgtgaag
ggcgaaggcacgaacaccgccacccctctggcctggagccacgccgagtacgtcaagctg
gtccgttcgctgaccgatcagagggtctgggaccactaccccgtcgtctcggacaagctc
gccaagtga

DBGET integrated database retrieval system