KEGG   Actinoalloteichus hoggarensis: AHOG_10345Help
Entry
AHOG_10345        CDS       T04975                                 

Definition
(GenBank) Actinorhodin polyketide putative beta-ketoacyl synthase 1
  KO
K05551  minimal PKS ketosynthase (KS/KS alpha) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg01056  Biosynthesis of type II polyketide backbone
ahg01100  Metabolic pathways
ahg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    AHOG_10345
   00253 Tetracycline biosynthesis
    AHOG_10345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahg01004]
    AHOG_10345
   01008 Polyketide biosynthesis proteins [BR:ahg01008]
    AHOG_10345
Enzymes [BR:ahg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     AHOG_10345
    2.3.1.260  tetracycline polyketide synthase
     AHOG_10345
    2.3.1.-  
     AHOG_10345
Lipid biosynthesis proteins [BR:ahg01004]
 Polyketide synthase
  Component type
   AHOG_10345
Polyketide biosynthesis proteins [BR:ahg01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     AHOG_10345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N DNA_processg_A
Motif
Other DBs
NCBI-ProteinID: ASO19712
UniProt: A0A221W1M8
LinkDB All DBs
Position
2338499..2339767
Genome map
AA seq 422 aa AA seqDB search
MNRKVVVTGIGVVAPGGVGREAFWDLLTAGRTATRTITMFDPSNFRSQIAAEADFDATAA
GLSAREIRRMDRAAQFAVVSAREALADSGIDLSGDPGRVGVSVGSAVGCTMGLEQEYAVL
SDNGRNWLVDHSYGVPHLYGYMVPSTLAVEVARDVAAEGPVSLISTGCTSGLDAVGHGAS
LIREGTADIVIAGATDAPLSPITSACFDAIKATSPRNDDAEHASRPFDATRNGFVLGEGS
AIMVLEEAESARRRGAHVYAELVGFAGRSNAFHMTGLKPDGREMAEAIRVALDQARINAS
DVDYINAHGSGTKQNDRHETAAFKRSLGERAYEVPVSSIKSMVGHSLGAIGSIEVAACAL
ALDRQVVPPTANLENSDPECDLDYVPKVARDHDMDVVLSVGSGFGGFQSAMLLARPGAVA
SL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgcaaggtcgtcgtcaccggcatcggagtcgtcgctccgggcggggtcggccgg
gaggccttctgggacctcctcacggccgggcgcaccgccacccggacgatcaccatgttc
gacccgtcgaacttccgatcgcagatcgccgccgaggcggacttcgacgcgaccgcggcg
gggctgagcgcccgggagatccgccggatggaccgcgccgcacagttcgcggtggtcagc
gctcgcgaggcgctggcggacagcgggatcgacctgtccggcgaccccggtcgcgtcggc
gtgagcgtcggcagcgcggtcggctgcacgatggggttggagcaggagtacgcggtcctc
tccgacaacggtcgcaactggctggtcgaccacagctacggcgtgccgcacctctacggc
tacatggtgcccagcaccctggcggtcgaggtggccagggacgtggccgcggaaggcccg
gtgagcctcatctccaccggctgcacgtcggggctcgacgcggtcggccacggcgcgtcg
ctcatcagggagggcaccgccgacatcgtgatcgccggtgccaccgacgcaccgctctcc
ccgatcacgtcggcctgcttcgacgccatcaaggccacctcgccccgcaacgacgacgcg
gagcacgcctcccggcccttcgacgccacgcgcaacggcttcgtcctcggtgagggcagc
gcgatcatggtgctggaggaggccgagtcggcccgacggcggggcgctcacgtctacgcc
gagctggtcggcttcgccgggcggagcaacgcctttcacatgacgggcctgaagcccgac
ggtcgggagatggccgaggcgatccgcgtcgcgctggaccaggcgcggatcaacgcctcg
gacgtcgactacatcaacgcgcacggctcggggaccaaacagaacgatcggcacgagacg
gcggcgttcaagcgcagtctcggcgagcgtgcctacgaggtgcccgtcagctccatcaag
tcgatggtcggccactcgctcggagccatcggctcgatcgaggtcgccgcctgcgcgctg
gctctcgaccggcaggtcgtgccgcccacggccaacctggagaactccgaccccgaatgt
gacctggactacgtgccgaaggtcgccagggaccacgacatggacgtcgtgctcagcgtc
ggcagcggtttcggcggcttccagagcgccatgctcctggcccgtccgggagccgtggct
tcgctgtaa

DBGET integrated database retrieval system