KEGG   Altererythrobacter sp. B11: AEB_P2172Help
Entry
AEB_P2172         CDS       T05671                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
alb00405  Phenazine biosynthesis
alb01100  Metabolic pathways
alb01110  Biosynthesis of secondary metabolites
alb01130  Biosynthesis of antibiotics
alb01230  Biosynthesis of amino acids
alb02024  Quorum sensing
Module
alb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AEB_P2172
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AEB_P2172
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AEB_P2172
Enzymes [BR:alb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AEB_P2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: BBC73040
UniProt: A0A2Z5YYI4
LinkDB All DBs
Position
complement(2274308..2275738)
Genome map
AA seq 476 aa AA seqDB search
MADTETPVGAALKLIEPGRGDFLLESVEGGAVRGRYSFLGLDPDLLFRASGAACEVNRRW
QQDREAFEPLERDSLTELRALAQSCRIDVPPELPSALTCLVGYFGYETIGLVEKLPRAPQ
SELDLPDMLFARPTLILVFDGLTDDLFCIAPVWAGGSDPVLAVERAGERIDEALRRLAAG
PAPLPQAEQLPPMDLQPVMDEADYAEMVRRAKEYITAGDIFQVVLAQRFTCPFPLPPLAL
YRALRRVNPSPFLYFLDLPGFAVVGSSPEILVRVRDGEVTIRPIAGTRPRGANAAEDREN
ERSLLADPKECAEHLMLLDLGRNDVGRVAAADSVAVTASFTIERYSHVMHIVSNVVGRLA
ADRDALDALFAGFPAGTVSGAPKIRACQVIAELEPETRGPYAGGVGYFAPDGSVDSCIVL
RTAVVKDGVMHVQAGAGIVADSEPAYEAAECRHKAGALIAAAREAARIAAEPGFGQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacacggagacgccggtcggcgcggcgctcaagctgatcgagccggggcgcggc
gatttcctgctcgaatccgtcgaaggcggcgcggtgcgcgggcgctattccttcctcggc
ctcgatcccgatctgctgttccgtgcgagcggtgccgcctgcgaggtcaaccgccgctgg
cagcaggatcgcgaagccttcgaaccgctggagcgcgacagcctcacggaactgcgcgcc
ctcgcccagtcctgccggatcgacgtgccgccggaactgccgagcgcgcttacctgcctc
gtcggctatttcggctacgagacgatcggcctggtcgagaagctgccccgcgcgccgcaa
agcgagctcgacctgccggacatgctgttcgcgcgccccacgctgatcctggtgttcgac
ggcctgaccgacgatctgttctgcatcgcccccgtatgggcgggcggaagcgatccggtg
ctggcagtggagcgcgccggcgagcgtatcgacgaggcgctgcgccgcctcgccgccggg
cccgcaccgctgccacaggcggaacagctgccgccgatggatctgcagccggtgatggac
gaggcggattatgccgagatggtccgccgcgcgaaggagtatatcactgcgggcgacatc
ttccaggtggtgctggcgcagcgtttcacctgccccttccccctgcccccgctggcgctc
tatcgggccctgcggcgggtgaacccctcgcccttcctctatttcctcgatctgccgggc
ttcgccgtggtgggatcgagccccgaaatcctcgtgcgcgtgcgcgatggcgaggtgacg
atccggccgatcgccggcacgcgcccacgcggtgccaatgcggcggaggatcgcgagaac
gagcgcagcctgctggccgatccgaaggaatgcgccgaacatctgatgctgctcgacctc
gggcgcaacgatgtcgggcgcgtggccgcggcggacagcgtcgctgtcaccgccagcttc
acgatcgagcgctacagccatgtgatgcacatcgtcagcaatgtggtcggccggctggcg
gcggatcgcgatgcgctggatgcgctgttcgccggcttccccgcgggtaccgtgtcgggc
gcgcccaagatccgcgcgtgtcaggtcatcgccgagctggagccggagacgcgcggcccc
tatgccggcggcgtcggctatttcgcgcccgatggctcagtcgacagctgcatcgtcctg
cgcaccgccgtggtgaaggacggggtgatgcatgtacaggccggggcgggcatcgtggcc
gatagcgagccggcctatgaagcggccgaatgccgccacaaggccggcgcgctgattgcc
gccgcgcgcgaggcggcgcggattgccgccgaacccggtttcgggcagtag

DBGET integrated database retrieval system