KEGG   Amycolatopsis mediterranei U32: AMED_6827Help
Entry
AMED_6827         CDS       T01269                                 

Definition
(RefSeq) glutamate dehydrogenase
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00220  Arginine biosynthesis
amd00250  Alanine, aspartate and glutamate metabolism
amd00430  Taurine and hypotaurine metabolism
amd00910  Nitrogen metabolism
amd01100  Metabolic pathways
amd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AMED_6827
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_6827
   00220 Arginine biosynthesis
    AMED_6827
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AMED_6827
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     AMED_6827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_GDH
Motif
Other DBs
NCBI-GeneID: 9440979
NCBI-ProteinID: YP_003768953
UniProt: A0A0H3DCV9
LinkDB All DBs
Position
complement(7523632..7528638)
Genome map
AA seq 1668 aa AA seqDB search
MSSTGVSSLPGTGADAEPEFGRRSPASPEQIRDDLIDAAAGLAPEIGELVRLYYRHLPPE
EIVGDEPVNLVGAVRSHLQLAKHRMPGRPAVRLLNPTVAEDGWAREATVVQVVTDDMPYL
VDSIAAEFARDGVQVQRIVHPIVVVTRDLTGELQEVHPEADPAEPPANSAAESWMYIEID
FVTDRNRARELDNRLSSVLGDVREVVEDAEKMGQTACQLASELETAPPQLPADEVAEGAR
LLRWLADGHFTFLGYRRYELIENPASDEHAAPALRAVLASGLGVLRQDSLAARGLTAGPD
TAATALAPTLLVLTQASAPSTVHRPVYPYYVGVKTFDAEGTVTGEHRFLGMFTTTALHEN
VLDIPVVGKRVREVIHRAGFPIESFSGQRMLEILQNWPRADLFSADSDSLYSTTTGAITL
SDRRRLRLFLRRDPYGRFYSCLVYLPRDRYTTRSRLAMQEVLLEELEGTQLEYSARIGET
VLAQVHFVVHTDPARRLEPDTLKIQDRLNDAVRTWDDRMVEAVLDERRERADGGVAVGIV
GEESATEQGQRFAMVFPEGYKEDFTAEEALADLRSLDSLTDEGDLALSFYQPADAGPGER
RFKLYLRGEGVTLSKVLPVLQAMGVEVVDERPYELHREDGGACWIYDFGLHVDQKMLDES
DGEAVAELRGRFQDAFEAAWRGDAEVDGLNGLVLRAGLTWRQAAVLRAYSRYLRQVGSAF
SQDYIQNTLLNHTQVATKLLRLFEARFDPQLSDADREAATDALTSELNAMIDEVTSLDED
RILRRLMAVIRATLRTNYHVTGADGKTRPYLAIKLDPAGVPDLPEPRPKFEIFVYSPRVE
GVHLRFGEVARGGLRWSDRREDFRTEILGLVKAQAVKNAVIVPVGAKGGFVVKRPPAPSG
DASIDRDAQLTEGIACYRMFISGLLDLTDNRIEGKTVPAPGVVRHDADDSYLVVAADKGT
AKFSDIANEVSAQYGFWLGDAFASGGSVGYDHKAMGITAKGAWESVKRHFRELGKNTQTE
DFTVVGIGDMMGDVFGNGMLLSEHIRLVAAFNHMHVFLDPDPDAAASYAERRRLFDLPRS
SWDDYDRSLISEGGGIYPRTAKSIPISPQVRVALGLEEGVTALAPMDLIQAILLAPVELL
WNGGIGTYVKAETESHQAAGDKANDAIRVDGHQLRVKVFGEGGNLGLTQLGRIEFARRGG
PGGAGGKINTDALDNSAGVDCSDHEVNIKILLDHLVQTGKLEREQRNELLEEMTDEVGAL
VLKDNYRQNAVLGVSRAHAAPMLSVHARQVQALVSAGAFDRKLEALPSNSEFRELEKAGK
GLTSPELATLLAHVKLELKDELLASDLPDSKVFAARLPEYFPKPLRERFGSAIGEHPLRR
QIITTLIANEVVDGGGISFVYRLMEEMNATATDAVRAYAVVTQVFDLPALWQEIDALDNV
VHTDVADEMVLETRRLLDRAARWFLTNRPQPLAPLSEIKRFGRVLGKLVPKIGDLLRGRE
AESVEKHVNELIAANVPEGLARRVSLLLHTYGLLDVTEVAELAEQQIGVDATHSPAETAE
LYYALSAHLDIDQMLTEISKLERGNRWHALARLSLRDDVYSSLRAITLDALRHSDPGSSG
DAKIAQWEKTNASRLQRARVALDEITKSGRLDLATLSVAARQIRSTVR
NT seq 5007 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaccggagtctcgtccctacccggaaccggagccgacgccgaacccgaattc
ggccggcgctccccggccagcccggagcagatcagggacgacctgatcgacgccgccgcc
gggctggcgccggagatcggtgagctcgtccggctctactaccggcacctcccgcccgaa
gagatcgtcggcgacgagccggtcaacctggtcggcgccgtgcggtcgcacctgcagctg
gccaagcaccggatgcccggccgcccggccgtgcggctgctgaacccgaccgtcgccgaa
gacgggtgggcgcgggaagccaccgtggtgcaggtcgtcaccgatgacatgccctacctg
gtcgactcgatcgccgcggagttcgcccgggacggcgtccaggtgcagcggatcgttcac
ccgatcgtggtggtcacccgggacctcaccggtgagctgcaggaggtccaccccgaagcg
gacccggccgagccgcccgcgaactcggccgccgagtcgtggatgtacatcgagatcgac
ttcgtcaccgatcgcaaccgggcccgcgagctcgacaaccggctctccagcgtgctgggc
gacgtccgcgaggtcgtcgaggacgccgagaagatgggccagacggcctgccagctggcg
agcgagctggagacggccccaccgcagctgcccgcggacgaggtcgccgagggcgcccgc
ctgctgcgctggctggccgacggccacttcaccttcctcggctaccgccgctacgagctg
atcgagaacccggcttccgatgagcacgccgcgccggccctgcgcgcggtcctggcctcg
ggcctgggcgtgctgcgccaggacagcctggccgcccgcggcctgaccgccggcccggac
accgccgccaccgccctagcgcccacgttgctggtgctgacccaggcgagcgcgccctcg
accgtgcaccggccggtctacccgtactacgtcggcgtgaagaccttcgacgccgagggc
accgtcaccggcgagcaccgcttcctcggcatgttcaccaccaccgcgctgcacgagaac
gtcctcgacatccccgtcgtcggcaagcgggtccgcgaggtcatccaccgcgccggcttc
ccgatcgagtcgttctccggccagcggatgctcgagatcctgcagaactggccgcgcgcc
gacctgttctccgccgacagcgactcgctgtactcgacgacgaccggcgcgatcaccctc
tccgatcgccgccggctgcggctgttcctgcgccgcgacccgtacggccgcttctactcc
tgcctcgtctacctcccgcgcgaccgctacacgacgcgctcgcggctggcgatgcaggaa
gtcctgctcgaagagctcgaaggcacccagctcgagtacagcgcgcggatcggcgagacc
gtcctggcgcaggtgcacttcgtcgtgcacaccgacccggcgcgccggctcgagccggac
acgctcaagatccaggaccggctgaacgacgccgtgcgcacctgggacgaccggatggtc
gaggcggtgctggacgaacgccgtgagcgcgccgatggcggggtcgcggtcgggatcgtc
ggcgaggaatcggccaccgagcagggccagcgcttcgcgatggtcttccccgagggctac
aaggaggacttcaccgccgaagaggcgctggccgacctccgctcactcgactcgctcacc
gacgaaggcgacctggcgctgtcgttctaccagcccgccgacgccgggccgggcgaacgg
cgcttcaagctctacctgcgcggtgagggcgtgacgctctcgaaggtgctcccggtgctg
caggccatgggcgtcgaggtggttgacgagcggccgtacgagctgcatcgcgaggacggc
ggcgcgtgctggatctacgacttcggcctgcacgtcgaccagaagatgctcgacgagtcc
gacggcgaagccgtcgccgagctgcgcggccgcttccaggacgccttcgaggccgcctgg
cggggtgacgccgaggtcgacggcctcaacggcctcgtcctgcgcgccgggctcacctgg
cgccaggccgccgtgctgcgcgcgtactcgcggtacctgcgccaggtcggcagcgcgttc
tcccaggactacatccagaacacgctgctgaaccacacccaggtcgcgaccaagctcctg
cggctgttcgaggcccggttcgacccgcagctgtccgacgccgaccgcgaggccgcgacc
gacgcgctgacgagcgagctcaacgcgatgatcgacgaggtcaccagcctcgacgaggac
cggatcctgcggcgcctgatggccgtcatccgggccaccctgcggacgaattaccacgtc
accggcgccgacgggaagacgcggccgtacctggccatcaagctcgacccggccggcgtg
cccgacctgcccgagccgcggccgaagttcgagatcttcgtgtactcgccgcgcgtcgag
ggcgtgcacctgcgtttcggcgaggtcgcgcgcggtggcctgcgctggtcggaccggcgc
gaggacttccgcaccgagatcctcggcctggtcaaggcgcaggcggtgaagaacgcggtg
atcgtgcccgtgggcgcgaagggcggcttcgtcgtcaagcggccgccggccccgagcggc
gacgcgagcatcgaccgcgacgcccagctcaccgagggcatcgcctgctaccgcatgttc
atctccggcctgctcgacctgaccgacaaccggatcgagggcaagaccgtgcccgccccg
ggggtcgtccggcacgacgccgacgactcctacctggtcgtcgccgccgacaagggcacc
gcgaagttctccgacatcgccaacgaggtctccgcgcagtacggcttctggctcggcgac
gccttcgcctccggcggctcggtcggctacgaccacaaggccatgggcatcacggcgaag
ggcgcttgggagagcgtcaagcggcacttccgcgagctgggcaaaaacacccagaccgag
gacttcaccgtggtcggcatcggcgacatgatgggggacgtcttcggcaacggcatgctg
ctgtccgagcacatccgcctggtcgcggcgttcaaccacatgcacgtcttcctcgacccg
gatccggacgcggcagcgtcgtacgccgagcgccgccggctgttcgacctgccgcgcagc
tcgtgggacgactacgaccgttcgctgatcagcgaaggcggcgggatctacccgcgcacg
gcgaagtcgatcccgatcagcccgcaggtccgcgtggccctcgggctcgaggagggcgtc
accgcgctggcgccgatggacctgatccaggcgatcctgctggccccggtcgagctgctg
tggaacggcggcatcggcacctacgtcaaggcggagaccgaaagccaccaggcagccggt
gacaaggccaacgacgccatccgcgtcgacggccaccagctgcgcgtcaaggtgttcggc
gaaggcggcaacctcggcctcacgcagctcggccggatcgagttcgcccgccgcggcggc
ccgggcggcgccggcggcaagatcaacaccgacgcactcgacaactcggccggggtcgac
tgctccgaccacgaggtcaacatcaagatcctgctcgaccacctcgtccagaccggcaag
ctggagcgcgaacagcgcaacgagctgctggaggagatgaccgacgaggtcggcgcgctg
gtcctcaaggacaactaccggcagaacgccgtgctcggcgtcagccgggcgcacgccgcg
ccgatgctgtcggtgcacgcgcgccaggtgcaggcgctggtgtcggcgggcgcgttcgac
cgcaagctcgaggcactgccgagcaactcggagttccgcgagctggagaaggcgggcaag
ggcctcacctcgccggagctggcgaccctgctcgcgcacgtcaagctggagctgaaggac
gagctgctggccagcgacctgcccgactcgaaggtgttcgcggcccggctgcccgagtac
ttcccgaagccgttgcgcgagcggttcggctccgcgatcggcgaacacccgctgcgccgc
cagatcatcaccacgctgatcgccaacgaagtggtcgacggcggtggcatctcgttcgtc
taccggctgatggaggagatgaacgcgacggcgacggacgcggtgcgcgcgtacgccgtg
gtgacgcaggtgttcgacctgcccgcgctgtggcaggagatcgacgcgctcgacaacgtc
gtgcacaccgacgtcgccgacgagatggtgctggagacgcggcggctgctcgaccgggcc
gcgcgctggttcctcaccaaccggccgcagccgctggccccgctctcggagatcaagcgc
ttcggccgcgtgctgggcaagctggtgccgaagatcggcgacctgctgcgcggccgcgag
gccgagtcggtggaaaagcacgtgaacgagctgatcgccgcgaacgtgccggaggggctg
gcccgccgggtttcgctgctgctgcacacctacggcctgctcgacgtcaccgaggtggcc
gagctcgccgagcagcagatcggcgtggacgccacgcacagcccggccgagacggcggag
ctgtactacgcgctctcggcgcacctggacatcgaccagatgctcaccgagatcagcaag
ctcgaacgcggcaaccgctggcacgcgctcgcccggctttcgctgcgcgacgacgtctac
agctcgctgcgcgcgatcacgctggatgcgttgcggcacagcgatcccggctcgtccggg
gacgccaagatcgcgcagtgggagaagacgaacgcgtcccggctgcagcgggcgcgcgtc
gcgctcgacgagatcaccaagtccggccggctcgacctggcgacgctttcggtggcggcc
cgccagatccggagcacagtacggtga

DBGET integrated database retrieval system