KEGG   Astyanax mexicanus (Mexican tetra): 103027950Help
Entry
103027950         CDS       T05042                                 

Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00250  Alanine, aspartate and glutamate metabolism
amex00410  beta-Alanine metabolism
amex00430  Taurine and hypotaurine metabolism
amex00650  Butanoate metabolism
amex01100  Metabolic pathways
Module
amex_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103027950
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103027950
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103027950
   00430 Taurine and hypotaurine metabolism
    103027950
Enzymes [BR:amex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103027950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS GxGYxYP_C
Motif
Other DBs
NCBI-GeneID: 103027950
NCBI-ProteinID: XP_007253561
Ensembl: ENSAMXG00000011292
UniProt: W5KVJ9
LinkDB All DBs
Position
19
AA seq 597 aa AA seqDB search
MAAWAPSSSAGEPDPNTANLRPPSSSYDWSGVAHGCTRKLGMKICGFLQKNNNLDEKSRI
VGAFTEQPSSKNLLTRDNERESHFRHTETDFSNLYARDLLPAKNGEEPTIQFLLELVDIL
TNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPNGEG
DGIFSPGGAISNMYSVMIARYKHFPEVKTKGMTAAPRLVLFTSEHSHYSIKKASAALGFG
TENLILLSTDERGRVIPADLEAKVIDAKKRGCVPLFVNATAGSTVYGAFDPINEIADICE
KYNMWLHVDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGLL
QGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEKHIDRCL
ELSEYLYNKIKNREGYVMVFQGQPQHTNVCFWYLPPNLRGMPEGDEKRQRLHKVAPKIKA
MMMECGTTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLIDEIERLGPGFIKSAQTF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgggcaccttcctcctccgccggcgagccagatcccaacacggctaattta
cgaccaccttcctcaagctatgactggagcggagtcgcacacgggtgtacgagaaaactg
gggatgaagatctgtggatttttacagaagaataataatctggacgagaagagtcggatt
gtaggcgcttttaccgagcaaccatcttcaaaaaacctgttaacccgggacaacgagaga
gagtcccacttcagacacacagaaacggacttctccaacctgtacgctagagatttactg
cctgccaaaaatggagaagagcctactatccagttcctgctggagctggtggatatcctc
acaaactatgtgcgcaagacatttgacagatccaccaaagtgctggatttccaccaccca
caccagctgctggagggtatggagggcttcaacctggagctttcagaccagccagagagc
ctggagcagatcctggtggactgtagagacacactcaaatacggcgtgaggacaggtcac
ccaaggttttttaaccagttgtcgaccggactggacatcattggcctggctggcgagtgg
ctcacctcgactgcaaacactaatatgttcacgtatgaaatcgctccagtgtttgtgcta
atggaacagctgactttgaagaagatgagggagatagttggatggcctaatggagaagga
gatggcatattttctccaggaggagcaatctccaacatgtacagtgtgatgatagctcgg
tataagcacttccctgaggtgaagactaaaggcatgacagcagctcctagactcgtgctc
ttcacttctgaacatagccactactccataaagaaagccagtgcagctcttgggtttggc
acagaaaacctgattttgctgagtacagatgagagaggtagagtcattcctgctgatctg
gaggccaaggtcattgatgccaaaaagagggggtgtgttccgctcttcgtgaacgccaca
gctggctccacggtctacggagctttcgaccccatcaatgagattgcagacatctgtgag
aaatacaacatgtggctccatgtggacggagcctggggaggtggactactgatgtccaga
aagcacagacacaagctgaatggcgtcgagagggcaaactctgtcacgtggaatcctcac
aagatgatgggcgttccattacagtgctctgccattctggtccgagagaaggggcttctg
cagggctgcaattctatgtgtgccggctacctgttccagcctgataaacagtacgatgtc
acctacgatactggcgacaaggccatacagtgcggcagacacgtggacatcttcaagttc
tggctcatgtggaaggcaaagggtaccattggatttgagaagcatatagaccggtgtttg
gagctttctgaatatctctacaataaaatcaagaatagagaaggctatgtcatggttttc
cagggacagcctcagcacactaatgtgtgcttctggtaccttcccccaaacttacgtggc
atgccagagggagacgagaagagacagaggctccataaggtggcccccaaaatcaaggca
atgatgatggagtgcggaacaacaatggtgggctaccagccacaaggagataaagtcaac
ttcttcaggatggtcatttcaaacccggccgccaccaggtcagacatcgacttcctgatc
gatgagatcgaaagactggggccaggatttataaagagcgcacagaccttttag

DBGET integrated database retrieval system