KEGG   Astyanax mexicanus (Mexican tetra): 103032190
Entry
103032190         CDS       T05042                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103032190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amex04052]
    103032190
Cytokines and growth factors [BR:amex04052]
 Cytokines
  CSF and other factors
   103032190
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103032190
NCBI-ProteinID: XP_022522952
Ensembl: ENSAMXG00000020004
LinkDB
Position
Unknown
AA seq 152 aa
MPSVSGLVNVVLMVLMWMGGCQASPLRAVCDPRVLERFIREARDTEAAMRSCGGSCAVTS
VYTVPLTNVDFTDWEQKDIEGQVAEVQVGLSLLVQALVAVRKTVSVSPISSLLDSNIINI
QSLIHIIHSLSSQVHLSLSHSHSLSLSLSRSP
NT seq 459 nt   +upstreamnt  +downstreamnt
atgccttcagtttctggtttggtgaatgtggtgctgatggtgctcatgtggatgggtggg
tgccaggcgtcccctctcagagcggtgtgtgacccgcgcgtgctggagcgcttcattaga
gaggccagagacacagaggcagccatgcggagctgtggaggaagctgtgctgtaacgagt
gtgtacacagttcccctgaccaatgttgactttaccgactgggagcagaaagatattgaa
ggacaggtagctgaggtgcaggtgggtttgtctctcttggtccaggctctagtcgcagtg
agaaagacggtcagcgtctctccgatcagcagcctactggacagtaacatcatcaacata
cagagcctgatccacatcatccacagcctcagctcacaggtgcatctctctctctctcac
tctcattcactctctctctctctctcgcgcagcccctga

DBGET integrated database retrieval system