KEGG   Astyanax mexicanus (Mexican tetra): 103033010
Entry
103033010         CDS       T05042                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103033010
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103033010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103033010
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103033010
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 103033010
NCBI-ProteinID: XP_022528264
LinkDB
Position
2
AA seq 744 aa
MAVWIQAQQLQGDALHQMQSLYGQHFPIEVRHYLSQWIEGQLWDAIDLENPQEEFKAKRL
LDSLIQELQKKAEHQVGEDGFLLKIKLGHYASQLKSTYDRCPLELVRCIKHILYTEQRLV
REANNSSSPLGGMIDSMSQKYQQINQAFEELRILTQDTENDLRKLQHNQEYFIIQYQESL
RIQAQLSSLATLPPADRQLREPSLLSKRATVEAWLTREANTLQKYRLGLAEKHQKTLALL
RKQQTVILDDELIQWKRRQQLAGNGGPPEGGLDILQSWCEKLAETIWQNRQQIRRAEHLR
QQLPIPGPIEELLNDLNSTITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFIVPDKVLWPQLCDALNMKYRAEVQSNRGLSEENLVFLAQKAFSS
SSCNPEDYRSMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPHWNDGAILGFVNK
QQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKTGERMVWNLMPYTTKDFSIRSL
ADRISDLNHLLFLYPDRPKDEVFSKYYTPPLSKAVDGYVKPQIKQVVPEFATPNPDPAAN
PTYMDHAASPAVSHPSNYGIYPAM
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggcagtgtggattcaggcccagcagctgcagggtgatgccctgcaccagatgcagtct
ctctatggccaacactttcctatagaggtgcgacactacctgtcccagtggatagaaggg
caactctgggatgcgatagatctggagaacccgcaggaggagtttaaagctaagcgtcta
ttggacagtctaattcaggaactacagaaaaaggcggagcatcaagtgggagaagacggt
ttcctccttaagattaaactaggccactacgcttcacagttaaagagcacgtatgaccgc
tgtccgctggagctggtgagatgcatcaaacatattctctacacagagcagagactcgtc
agagaagccaataattcgagctcaccgctgggtgggatgatagacagcatgtctcagaaa
tatcagcagatcaaccaggccttcgaggagctgcggatcctgacacaggacacggagaac
gacctgcgcaaactacagcacaaccaggagtacttcatcatacagtaccaggagagtcta
cgaatacaggctcagctgagcagcctggccacgttgccccccgctgacagacagctgaga
gagcccagcctcctcagtaagagagctactgtagaggcctggcttaccagagaggctaac
accctacagaaatacagactgggactggcagagaagcatcaaaagacactggccttgttg
cggaaacagcagacggtgattttggatgacgagctaattcagtggaagaggcgtcagcaa
ctggctggtaacggaggaccaccagaggggggactagacattcttcagtcatggtgtgag
aaactggcagagaccatttggcagaacagacagcagatcagaagggcggagcatttaagg
cagcagctgcccattcccggccccatagaggagctgctcaatgacctcaacagcaccatc
actgacatcatctcagccctcgtaaccagcaccttcatcatagagaagcagcctcctcag
gtgttgaagacccagacgaagtttgcagctacagtccgtctgctggtggggggcaaactc
aacgtccacatgaacccccctcaggtcaaagctaccatcatcagcgaacagcaggccaaa
gccttgctcaagaatgaaaacaccagaaatgacagcagcggagagatcctgaataataac
tgtgtgatggagtaccaccaaaccacaggcactctgagtgcacactttaggaatatgtct
ctgaagaggatcaagcgttcggaccgcagaggggcggagtctgttacagaggagaagttc
accatcttgtttgagtcgcagtttagtgttggaggcaacgagctagtttttcaggtcaag
acgctatccttgcctgttgtagtgattgtccatggaagtcaagacaacaatgccacagcc
acagttctgtgggacaatgctttcgcagagccgggccgggtacctttcatagtgccggac
aaggtgctgtggccacagttgtgtgatgctctcaacatgaagtacagggcggaggtgcag
tccaacagaggcctctctgaggagaacctggtgttcctcgcccagaaagctttcagcagc
tccagctgcaacccggaggattaccgcagtatgaccatgacctggtcccagttcaacagg
gaaagtctgccgggcaggaacttcacgttctggcagtggtttgacggcgtcatggagctc
actaaaaaacatctgaagcctcactggaacgatggggccattctgggctttgtgaataag
cagcaagctcaggacatgctgatgtccaaacctaacggcacgttcctgctgcggttcagt
gattcagagataggaggcatcaccatcgcctgggtggcagaaaaccccaacaaaacaggg
gagagaatggtgtggaacctcatgccctacacaaccaaagacttctctattcgctctctg
gctgaccgcatcagtgacctgaaccacctgctgttcctgtaccccgatcgacccaaagac
gaggttttctccaaatactacacccctccactctcgaaagccgtggacggctacgtcaaa
ccacagatcaaacaagtggtgccagagtttgcaacgcctaatcctgacccagcagcgaac
cccacctacatggatcatgcagcatcgccggccgtcagtcacccatcaaactacggcatt
tatcctgcaatgtaa

DBGET integrated database retrieval system