KEGG   Acropora millepora: 114960299
Entry
114960299         CDS       T06134                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
amil  Acropora millepora
Pathway
amil04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:amil00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114960299
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114960299
NCBI-ProteinID: XP_029194457
LinkDB
Position
Unknown
AA seq 207 aa
MLPPVMAMAFTQGVTSSSSRRRERPNIVPSRSVCRNLFGPVDHEQLKADFLREKEEIIKE
DTRKWNFDFENDIPLLGRYLWEKMYSDLARERTTSSFSSRASEGKATNERSSCTTVAEHP
DVTPSATSLDMAHRTIQISDNVDSEKPESEKCDPKMTPRKLRSRSSTGKITDFLRPRKQR
RSVKRLQLKTRESTSKQTSLDVLFRKH
NT seq 624 nt   +upstreamnt  +downstreamnt
atgttgcccccagtcatggcaatggcttttacacagggagtaacttcgtcttcttctcgt
cggagagaaagaccaaacattgtcccctcaaggtcggtctgcagaaacctgtttggcccg
gtcgatcacgagcaattgaaagcagattttcttcgagagaaggaagaaattatcaaggaa
gacactcgaaagtggaacttcgattttgagaatgacattccgttgcttggaagatatctt
tgggaaaaaatgtactctgacttggcaagagagcgaacaacctcgagtttttcttcccgt
gcaagcgaagggaaagcaacaaacgaacgctcaagttgtactacagtcgccgaacaccct
gatgttactccttcagcaacaagtttggacatggcacatcgtacgatacagatatcggat
aacgtagacagcgagaaacctgaaagtgaaaaatgcgacccaaaaatgaccccgaggaag
ctcagaagtaggagctcaacaggaaaaattacagattttttgcggccgcggaaacaaagg
cgatctgtcaaaaggttacagctcaaaacgcgagaatcaacatcgaagcaaacaagtttg
gacgtgttatttcgcaaacattaa

DBGET integrated database retrieval system