KEGG   Ailuropoda melanoleuca (giant panda): 100463584
Entry
100463584         CDS       T01329                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X2
  KO
K13376  transforming growth factor beta-2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04218  Cellular senescence
aml04350  TGF-beta signaling pathway
aml04380  Osteoclast differentiation
aml04390  Hippo signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05144  Malaria
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05220  Chronic myeloid leukemia
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05321  Inflammatory bowel disease
aml05323  Rheumatoid arthritis
aml05410  Hypertrophic cardiomyopathy
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100463584 (TGFB2)
   04350 TGF-beta signaling pathway
    100463584 (TGFB2)
   04390 Hippo signaling pathway
    100463584 (TGFB2)
   04068 FoxO signaling pathway
    100463584 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100463584 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100463584 (TGFB2)
   04218 Cellular senescence
    100463584 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100463584 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100463584 (TGFB2)
   05206 MicroRNAs in cancer
    100463584 (TGFB2)
   05205 Proteoglycans in cancer
    100463584 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100463584 (TGFB2)
   05212 Pancreatic cancer
    100463584 (TGFB2)
   05225 Hepatocellular carcinoma
    100463584 (TGFB2)
   05226 Gastric cancer
    100463584 (TGFB2)
   05220 Chronic myeloid leukemia
    100463584 (TGFB2)
   05211 Renal cell carcinoma
    100463584 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100463584 (TGFB2)
   05321 Inflammatory bowel disease
    100463584 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100463584 (TGFB2)
   05414 Dilated cardiomyopathy
    100463584 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100463584 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100463584 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100463584 (TGFB2)
   05161 Hepatitis B
    100463584 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100463584 (TGFB2)
   05144 Malaria
    100463584 (TGFB2)
   05145 Toxoplasmosis
    100463584 (TGFB2)
   05140 Leishmaniasis
    100463584 (TGFB2)
   05142 Chagas disease
    100463584 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100463584 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100463584 (TGFB2)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100463584 (TGFB2)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100463584 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100463584
NCBI-ProteinID: XP_002923136
Ensembl: ENSAMEG00000010879
LinkDB
Position
8
AA seq 414 aa
MHYCVLSAFLFLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgttcctgcatctggtcacggctgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagtttatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactatcccgaaccc
gaggaagtacccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaaatgccatcccgccc
actttctacagaccctacttcagaattgtccgatttgacgtctcggcgatggagaagaat
gcatccaatttggtgaaagcagagttcagagtctttcgtttacagaacccgaaagccagg
gtgcccgaacaacggatcgagctgtatcagattctcaaatccaaagatttaacgtctcca
acccagcgctacattgacagtaaagttgtcaagacgagagcagaaggcgaatggctttcc
tttgacgtgactgacgccgtccatgaatggctccaccataaagacagaaacctgggattt
aaaataagtttacactgtccctgctgcacctttgtaccatctaataattacatcattccc
aataaaagtgaagagctagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagacttgagtcacaacagtccaaccggcggaag
aagcgtgctttggatgcagcctattgttttagaaatgtgcaggataattgctgcctacgt
ccactttacatagatttcaagagggatcttgggtggaaatggatacatgaacctaaaggg
tacaatgccaacttctgtgctggagcgtgcccgtatttatggagctcagacactcagcac
agtagggttctcagcctgtataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaggatttagaaccgctaaccattctctactacatcggcaaaacacccaagatt
gaacaactctctaatatgatcgtaaagtcttgcaagtgcagctaa

KEGG   Ailuropoda melanoleuca (giant panda): 100470703
Entry
100470703         CDS       T01329                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 proprotein isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04218  Cellular senescence
aml04350  TGF-beta signaling pathway
aml04380  Osteoclast differentiation
aml04390  Hippo signaling pathway
aml04659  Th17 cell differentiation
aml04672  Intestinal immune network for IgA production
aml04926  Relaxin signaling pathway
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05144  Malaria
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05220  Chronic myeloid leukemia
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05321  Inflammatory bowel disease
aml05323  Rheumatoid arthritis
aml05410  Hypertrophic cardiomyopathy
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100470703 (TGFB1)
   04350 TGF-beta signaling pathway
    100470703 (TGFB1)
   04390 Hippo signaling pathway
    100470703 (TGFB1)
   04068 FoxO signaling pathway
    100470703 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100470703 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100470703 (TGFB1)
   04218 Cellular senescence
    100470703 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100470703 (TGFB1)
   04672 Intestinal immune network for IgA production
    100470703 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100470703 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100470703 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470703 (TGFB1)
   05205 Proteoglycans in cancer
    100470703 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100470703 (TGFB1)
   05212 Pancreatic cancer
    100470703 (TGFB1)
   05225 Hepatocellular carcinoma
    100470703 (TGFB1)
   05226 Gastric cancer
    100470703 (TGFB1)
   05220 Chronic myeloid leukemia
    100470703 (TGFB1)
   05211 Renal cell carcinoma
    100470703 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100470703 (TGFB1)
   05321 Inflammatory bowel disease
    100470703 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100470703 (TGFB1)
   05414 Dilated cardiomyopathy
    100470703 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100470703 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100470703 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100470703 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100470703 (TGFB1)
   05161 Hepatitis B
    100470703 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100470703 (TGFB1)
   05144 Malaria
    100470703 (TGFB1)
   05145 Toxoplasmosis
    100470703 (TGFB1)
   05140 Leishmaniasis
    100470703 (TGFB1)
   05142 Chagas disease
    100470703 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aml03110]
    100470703 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100470703 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100470703 (TGFB1)
Chaperones and folding catalysts [BR:aml03110]
 Intramolecular chaperones
  Others
   100470703 (TGFB1)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100470703 (TGFB1)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100470703 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100470703
NCBI-ProteinID: XP_034528214
LinkDB
Position
12
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENTNRI
YEKIKKSPHSIYMLFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNDSWR
YLSNRLLAPSDTPEWLSFDVTGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTLQVDINAGF
SSSRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgctgctgtggctactagtg
ctgacgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggaactg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggctgtgctggccctt
tacaacagtacccgcgaccgggtggcgggggagagcgccgagccggagcccgagcctgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacaccaacagaatc
tatgagaaaatcaaaaagagcccacacagcatctatatgctcttcaacacatcggagctc
cgagaagcagtgcccgagcccgtcttgctctcccgggcggagctgcgcctgctgaggctc
aagttgaaagccgagcagcacgtggagctgtaccagaaatatagcaacgattcctggcgc
tacctcagcaaccggctgctggcgcccagcgacacgccagaatggctgtccttcgatgtc
actggagtcgtgcgacagtggctgagccacggaggggaagtagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataatacactgcaagtggatatcaacgcagggttc
agttccagccgccgaggtgacctggccaccattcacggcatgaaccggcccttcctgctc
ctcatggccaccccactggagagggcccaacatctgcacagctcccgacatcgccgggcc
ctggacaccaactactgcttcagctccaccgagaagaactgctgcgtgcggcagctctac
atcgacttccgcaaggatctgggctggaagtggatccacgagcccaagggctaccatgcc
aacttctgcctggggccctgcccctacatttggagcctggacacgcagtacagcaaggtc
ctggcgctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcag
gcgctggagcccctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Ailuropoda melanoleuca (giant panda): 100475861
Entry
100475861         CDS       T01329                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 proprotein isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04218  Cellular senescence
aml04350  TGF-beta signaling pathway
aml04390  Hippo signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05144  Malaria
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05220  Chronic myeloid leukemia
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05321  Inflammatory bowel disease
aml05323  Rheumatoid arthritis
aml05410  Hypertrophic cardiomyopathy
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100475861 (TGFB3)
   04350 TGF-beta signaling pathway
    100475861 (TGFB3)
   04390 Hippo signaling pathway
    100475861 (TGFB3)
   04068 FoxO signaling pathway
    100475861 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100475861 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100475861 (TGFB3)
   04218 Cellular senescence
    100475861 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475861 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100475861 (TGFB3)
   05212 Pancreatic cancer
    100475861 (TGFB3)
   05225 Hepatocellular carcinoma
    100475861 (TGFB3)
   05226 Gastric cancer
    100475861 (TGFB3)
   05220 Chronic myeloid leukemia
    100475861 (TGFB3)
   05211 Renal cell carcinoma
    100475861 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100475861 (TGFB3)
   05321 Inflammatory bowel disease
    100475861 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100475861 (TGFB3)
   05414 Dilated cardiomyopathy
    100475861 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100475861 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100475861 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100475861 (TGFB3)
   05161 Hepatitis B
    100475861 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100475861 (TGFB3)
   05144 Malaria
    100475861 (TGFB3)
   05145 Toxoplasmosis
    100475861 (TGFB3)
   05140 Leishmaniasis
    100475861 (TGFB3)
   05142 Chagas disease
    100475861 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100475861 (TGFB3)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100475861 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100475861
NCBI-ProteinID: XP_002914754
Ensembl: ENSAMEG00000018349
LinkDB
Position
14
AA seq 412 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgagccatcg
gtgatgacccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcagggggagagggaggacagctgcactcaggaaaacaccgagtcggagtac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaatgagctg
gctgtctgccccaaagggatcacctccaaggttttccgcttcaacgtgtcctcagtggag
aaaaatggaaccaacctgttccgagcagaattccgggtcttgagggtgcccaaccccagc
tccaagcgcagcgaacagaggatcgagctcttccagatactccggcccgatgagcacatt
gccaaacagcgctatatcggcggcaagaatctgcccacacggggcaccgccgagtggctg
tcctttgatgtcactgacactgtgcgtgagtggctcttgcgaagagagtccaacttaggt
ctggaaatcagcattcactgtccatgtcacacctttcagcccaatggagacatcctggaa
aacattcatgaggtgatggaaatcaaattcaaaggtgtggacagcgaggatgatcatggc
cgtggggacctagggcgcctcaagaagcagaaggaccaccacaaccctcacctcatcctg
atgatgattcccccgcaccggctggacaacccaggccagggtgggcagaggaagaagcgg
gccctggacaccaattactgcttccgcaatttggaggagaactgctgtgtgcgccctctc
tacattgacttccgacaagatctgggctggaaatgggtccatgaacctaagggctactac
gccaacttctgctcaggcccctgtccctacctccgcagcgcggacacaacccacagcacg
gtgctgggactgtacaacactctgaatcctgaagcatccgcctcaccttgctgtgtgccc
caggacttggagcccctgaccatcctgtactacgtcggcaggacccccaaggtggaacag
ctgtctaacatggtggtcaagtcctgtaagtgtagctga

DBGET integrated database retrieval system