KEGG   Ailuropoda melanoleuca (giant panda): 100463775
Entry
100463775         CDS       T01329                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05100  Bacterial invasion of epithelial cells
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05146  Amoebiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100463775 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100463775 (PIK3CB)
   04014 Ras signaling pathway
    100463775 (PIK3CB)
   04015 Rap1 signaling pathway
    100463775 (PIK3CB)
   04370 VEGF signaling pathway
    100463775 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100463775 (PIK3CB)
   04668 TNF signaling pathway
    100463775 (PIK3CB)
   04066 HIF-1 signaling pathway
    100463775 (PIK3CB)
   04068 FoxO signaling pathway
    100463775 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100463775 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100463775 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100463775 (PIK3CB)
   04024 cAMP signaling pathway
    100463775 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100463775 (PIK3CB)
   04152 AMPK signaling pathway
    100463775 (PIK3CB)
   04150 mTOR signaling pathway
    100463775 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100463775 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100463775 (PIK3CB)
   04218 Cellular senescence
    100463775 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100463775 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100463775 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100463775 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100463775 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    100463775 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100463775 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100463775 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100463775 (PIK3CB)
   04660 T cell receptor signaling pathway
    100463775 (PIK3CB)
   04662 B cell receptor signaling pathway
    100463775 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100463775 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100463775 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100463775 (PIK3CB)
   04062 Chemokine signaling pathway
    100463775 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100463775 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100463775 (PIK3CB)
   04929 GnRH secretion
    100463775 (PIK3CB)
   04915 Estrogen signaling pathway
    100463775 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100463775 (PIK3CB)
   04917 Prolactin signaling pathway
    100463775 (PIK3CB)
   04926 Relaxin signaling pathway
    100463775 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100463775 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100463775 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100463775 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100463775 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100463775 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100463775 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100463775 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100463775 (PIK3CB)
   04380 Osteoclast differentiation
    100463775 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100463775 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100463775 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100463775 (PIK3CB)
   05206 MicroRNAs in cancer
    100463775 (PIK3CB)
   05205 Proteoglycans in cancer
    100463775 (PIK3CB)
   05203 Viral carcinogenesis
    100463775 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100463775 (PIK3CB)
   05231 Choline metabolism in cancer
    100463775 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100463775 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100463775 (PIK3CB)
   05212 Pancreatic cancer
    100463775 (PIK3CB)
   05225 Hepatocellular carcinoma
    100463775 (PIK3CB)
   05226 Gastric cancer
    100463775 (PIK3CB)
   05214 Glioma
    100463775 (PIK3CB)
   05221 Acute myeloid leukemia
    100463775 (PIK3CB)
   05220 Chronic myeloid leukemia
    100463775 (PIK3CB)
   05218 Melanoma
    100463775 (PIK3CB)
   05211 Renal cell carcinoma
    100463775 (PIK3CB)
   05215 Prostate cancer
    100463775 (PIK3CB)
   05213 Endometrial cancer
    100463775 (PIK3CB)
   05224 Breast cancer
    100463775 (PIK3CB)
   05222 Small cell lung cancer
    100463775 (PIK3CB)
   05223 Non-small cell lung cancer
    100463775 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100463775 (PIK3CB)
   05017 Spinocerebellar ataxia
    100463775 (PIK3CB)
   05020 Prion disease
    100463775 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100463775 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100463775 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100463775 (PIK3CB)
   04931 Insulin resistance
    100463775 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100463775 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100463775 (PIK3CB)
   05135 Yersinia infection
    100463775 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100463775 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100463775 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100463775 (PIK3CB)
   05161 Hepatitis B
    100463775 (PIK3CB)
   05160 Hepatitis C
    100463775 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    100463775 (PIK3CB)
   05164 Influenza A
    100463775 (PIK3CB)
   05162 Measles
    100463775 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100463775 (PIK3CB)
   05163 Human cytomegalovirus infection
    100463775 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100463775 (PIK3CB)
   05169 Epstein-Barr virus infection
    100463775 (PIK3CB)
   05165 Human papillomavirus infection
    100463775 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100463775 (PIK3CB)
   05142 Chagas disease
    100463775 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100463775 (PIK3CB)
   01524 Platinum drug resistance
    100463775 (PIK3CB)
   01522 Endocrine resistance
    100463775 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100463775 (PIK3CB)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100463775 (PIK3CB)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100463775 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 100463775
NCBI-ProteinID: XP_034517804
Ensembl: ENSAMEG00000005226
LinkDB
Position
6
AA seq 797 aa
MNRTLPHFMLVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKMRIISHVWENNNPF
QIVLVKGNKLNTEESVKVHVRAGLFHGTELLCKTIVSSEISGKNDHIWNEPLEFDINTCD
LPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLR
SGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHIKFPETKKQPYYYPPFDKIIE
KAAEIASSDSANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSL
PKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDE
ELSQYLLQLVQVLKYEPFLDCALSRFLLERALANRRIGQFLFWHLRSEVHIPAVSVQFGV
ILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYRE
ALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQD
MLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAAA
AAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQL
FHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLIL
RRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESW
TTKVNWMAHTVRKDYRS
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgaacaggaccttgccccattttatgcttgtggaatgttgcaagatcaagaagatgtat
gaacaggaaatgattgccatagaggctgccataaatcgaaattcatcaaaccttcctctt
cctttaccaccaaagaaaatgcgaattatttctcatgtttgggaaaataacaaccctttc
caaattgtgttggttaagggaaataaacttaacacagaagaaagtgtaaaagttcatgtc
agggctggcctttttcatggtactgaactcctctgtaaaaccatcgtaagctcagagata
tcagggaaaaatgatcacatttggaatgaaccactggaatttgatataaatacttgtgac
ctgccacgaatggctcgattatgttttgctgtttatgcagttttggataaagtgaaaacg
aaaaagtcgactaaaactattaatccctctaaatatcagaccatccggaaatctgggaaa
gtgcattatcctgtagcatgggtaaatacgatggtttttgactttaaaggacagttgaga
tccggagacataatattgcacagctggtcttcatttcctgatgaacttgaagaaatgttg
aatccaatgggaactgttcaaacaaatccatatactgaaaatgcaacagctttgcatatc
aaattcccagagactaaaaaacaaccttactattatcctcccttcgataagataatcgag
aaggcagctgagattgcaagcagtgacagtgctaatgtatccagtcgaggtggaaaaaag
tttcttgctgtactgaaagaaatcttggacagggatcccttgtctcagttgtgtgagaat
gaaatggatcttatttggactttgcgacaagattgcagagagaatttcccacagtcactg
ccaaaattactgctgtcaatcaagtggaataaacttgaggatgttgctcagcttcaggca
ctacttcagatttggcctaaactgcccccccgggaggccttagagcttctagatttcaac
tatccagatcagtacgtgcgagaatatgctgtgggctgcctgcgacagatgagtgatgaa
gaactctctcaatatcttttacaactggtgcaagttttaaaatatgagccttttcttgat
tgtgccctctctagattcctattagaaagagcactggctaatcggaggatagggcaattt
ctattttggcaccttaggtcagaagtgcatattcctgctgtctcagtacagtttggtgtc
atccttgaagcatactgccggggaagtgtagggcacatgaaagtgctttctaagcaggtt
gaagcactcaataagttaaaaactttaaatagtttaatcaaactgaatgcaatgaagcta
aacagagccaaagggaaggaggccatgcatacttgtttaaaacagaacgcttaccgggaa
gccctctctgacctgcagtcgcctctgaatccatgtgttatcctctcagaactctatgtt
gaaaagtgtaaatacatggattccaaaatgaagcctttgtggctcgtgtacaataacaaa
gtgttcggtgaggattcagttggagtgatttttaaaaatggtgatgatttacgacaagat
atgttgacactccaaatgctgcgcttgatggatttactttggaaagaagctggtctggat
cttcggatgctgccttatggctgtttagcaacaggagaccgctctggcctcattgaagtt
gtgagcacctctgaaacaattgctgacattcagctgaacagtagcaacgtggctgctgca
gcagccttcaacaaagatgcccttctgaactggcttaaagaatacaattctggggatgac
ctagaccgagccattgaggagtttaccttgtcctgtgccggctactgtgtagcttcttat
gtccttgggattggtgatagacatagtgacaacatcatggtcaaaaaaaccggccagctc
ttccacattgactttggacatattcttggaaatttcaagtctaaatttggcattaaaagg
gaacgggtgccttttattcttacctatgatttcattcatgtgattcaacaaggaaaaaca
ggaaacacagagaagtttggccgcttccgccagtgttgtgaggatgcatatctgattcta
cgacggcacgggaatctcttcatcactctttttgcactgatgctgactgcagggcttcct
gagctcacatcagtcaaggatatacagtatcttaaggactctcttgccttagggaagagt
gaagaagaagcactcaagcagtttaagcaaaaatttgatgaggcactcagggaaagctgg
actactaaagtaaactggatggcccacacagttcggaaagactacagatcttaa

KEGG   Ailuropoda melanoleuca (giant panda): 100467916
Entry
100467916         CDS       T01329                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05100  Bacterial invasion of epithelial cells
aml05135  Yersinia infection
aml05142  Chagas disease
aml05146  Amoebiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100467916 (PIK3R3)
   04014 Ras signaling pathway
    100467916 (PIK3R3)
   04015 Rap1 signaling pathway
    100467916 (PIK3R3)
   04370 VEGF signaling pathway
    100467916 (PIK3R3)
   04630 JAK-STAT signaling pathway
    100467916 (PIK3R3)
   04668 TNF signaling pathway
    100467916 (PIK3R3)
   04066 HIF-1 signaling pathway
    100467916 (PIK3R3)
   04068 FoxO signaling pathway
    100467916 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    100467916 (PIK3R3)
   04072 Phospholipase D signaling pathway
    100467916 (PIK3R3)
   04071 Sphingolipid signaling pathway
    100467916 (PIK3R3)
   04024 cAMP signaling pathway
    100467916 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    100467916 (PIK3R3)
   04152 AMPK signaling pathway
    100467916 (PIK3R3)
   04150 mTOR signaling pathway
    100467916 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100467916 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    100467916 (PIK3R3)
   04218 Cellular senescence
    100467916 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100467916 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100467916 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100467916 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100467916 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    100467916 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    100467916 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    100467916 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    100467916 (PIK3R3)
   04660 T cell receptor signaling pathway
    100467916 (PIK3R3)
   04662 B cell receptor signaling pathway
    100467916 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    100467916 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    100467916 (PIK3R3)
   04670 Leukocyte transendothelial migration
    100467916 (PIK3R3)
   04062 Chemokine signaling pathway
    100467916 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100467916 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    100467916 (PIK3R3)
   04929 GnRH secretion
    100467916 (PIK3R3)
   04915 Estrogen signaling pathway
    100467916 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    100467916 (PIK3R3)
   04917 Prolactin signaling pathway
    100467916 (PIK3R3)
   04926 Relaxin signaling pathway
    100467916 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    100467916 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    100467916 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100467916 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100467916 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    100467916 (PIK3R3)
   04722 Neurotrophin signaling pathway
    100467916 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100467916 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    100467916 (PIK3R3)
   04380 Osteoclast differentiation
    100467916 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    100467916 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    100467916 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467916 (PIK3R3)
   05206 MicroRNAs in cancer
    100467916 (PIK3R3)
   05205 Proteoglycans in cancer
    100467916 (PIK3R3)
   05203 Viral carcinogenesis
    100467916 (PIK3R3)
   05230 Central carbon metabolism in cancer
    100467916 (PIK3R3)
   05231 Choline metabolism in cancer
    100467916 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100467916 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100467916 (PIK3R3)
   05212 Pancreatic cancer
    100467916 (PIK3R3)
   05225 Hepatocellular carcinoma
    100467916 (PIK3R3)
   05226 Gastric cancer
    100467916 (PIK3R3)
   05214 Glioma
    100467916 (PIK3R3)
   05221 Acute myeloid leukemia
    100467916 (PIK3R3)
   05220 Chronic myeloid leukemia
    100467916 (PIK3R3)
   05218 Melanoma
    100467916 (PIK3R3)
   05211 Renal cell carcinoma
    100467916 (PIK3R3)
   05215 Prostate cancer
    100467916 (PIK3R3)
   05213 Endometrial cancer
    100467916 (PIK3R3)
   05224 Breast cancer
    100467916 (PIK3R3)
   05222 Small cell lung cancer
    100467916 (PIK3R3)
   05223 Non-small cell lung cancer
    100467916 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100467916 (PIK3R3)
   05017 Spinocerebellar ataxia
    100467916 (PIK3R3)
   05020 Prion disease
    100467916 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100467916 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100467916 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    100467916 (PIK3R3)
   04931 Insulin resistance
    100467916 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100467916 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100467916 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    100467916 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100467916 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    100467916 (PIK3R3)
   05161 Hepatitis B
    100467916 (PIK3R3)
   05160 Hepatitis C
    100467916 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    100467916 (PIK3R3)
   05164 Influenza A
    100467916 (PIK3R3)
   05162 Measles
    100467916 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    100467916 (PIK3R3)
   05163 Human cytomegalovirus infection
    100467916 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100467916 (PIK3R3)
   05169 Epstein-Barr virus infection
    100467916 (PIK3R3)
   05165 Human papillomavirus infection
    100467916 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100467916 (PIK3R3)
   05142 Chagas disease
    100467916 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100467916 (PIK3R3)
   01524 Platinum drug resistance
    100467916 (PIK3R3)
   01522 Endocrine resistance
    100467916 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100467916 (PIK3R3)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100467916 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 PI_PP_I DUF5638 Exonuc_VII_L
Other DBs
NCBI-GeneID: 100467916
NCBI-ProteinID: XP_034507644
LinkDB
Position
2
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEEADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagccgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaagtaaatgacaaattacgg
gatatgccagatggtacgttcttggtcagagatgcctcaacaaaaatgcagggggattac
actttgactttgaggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatacgggttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgagtctcttgctcagtacaatcccaaacttgatgtgaagctaatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagacaacatcgacgcagttggtaaaaaa
ctgcaggagtaccactctcagtatcaggaaaagagtaaagagtatgacaggctatatgag
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcaatgtcacacgcaggaacaacatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtgagacagaagcgtctaaatgcctggctgggaatcaagaatgaggaggctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaagacttgctttatgggaaacctgatggtgcattt
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggag
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtacagctcactgaaggagctggtgctccattaccagcagacatccctcgttcagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcactctgc
agataa

KEGG   Ailuropoda melanoleuca (giant panda): 100475291
Entry
100475291         CDS       T01329                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05100  Bacterial invasion of epithelial cells
aml05135  Yersinia infection
aml05142  Chagas disease
aml05146  Amoebiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100475291 (PIK3R2)
   04014 Ras signaling pathway
    100475291 (PIK3R2)
   04015 Rap1 signaling pathway
    100475291 (PIK3R2)
   04370 VEGF signaling pathway
    100475291 (PIK3R2)
   04630 JAK-STAT signaling pathway
    100475291 (PIK3R2)
   04668 TNF signaling pathway
    100475291 (PIK3R2)
   04066 HIF-1 signaling pathway
    100475291 (PIK3R2)
   04068 FoxO signaling pathway
    100475291 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    100475291 (PIK3R2)
   04072 Phospholipase D signaling pathway
    100475291 (PIK3R2)
   04071 Sphingolipid signaling pathway
    100475291 (PIK3R2)
   04024 cAMP signaling pathway
    100475291 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    100475291 (PIK3R2)
   04152 AMPK signaling pathway
    100475291 (PIK3R2)
   04150 mTOR signaling pathway
    100475291 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100475291 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    100475291 (PIK3R2)
   04218 Cellular senescence
    100475291 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100475291 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100475291 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100475291 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100475291 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    100475291 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    100475291 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    100475291 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    100475291 (PIK3R2)
   04660 T cell receptor signaling pathway
    100475291 (PIK3R2)
   04662 B cell receptor signaling pathway
    100475291 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    100475291 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    100475291 (PIK3R2)
   04670 Leukocyte transendothelial migration
    100475291 (PIK3R2)
   04062 Chemokine signaling pathway
    100475291 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100475291 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    100475291 (PIK3R2)
   04929 GnRH secretion
    100475291 (PIK3R2)
   04915 Estrogen signaling pathway
    100475291 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    100475291 (PIK3R2)
   04917 Prolactin signaling pathway
    100475291 (PIK3R2)
   04926 Relaxin signaling pathway
    100475291 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    100475291 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    100475291 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100475291 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100475291 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    100475291 (PIK3R2)
   04722 Neurotrophin signaling pathway
    100475291 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100475291 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100475291 (PIK3R2)
   04380 Osteoclast differentiation
    100475291 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    100475291 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    100475291 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475291 (PIK3R2)
   05206 MicroRNAs in cancer
    100475291 (PIK3R2)
   05205 Proteoglycans in cancer
    100475291 (PIK3R2)
   05203 Viral carcinogenesis
    100475291 (PIK3R2)
   05230 Central carbon metabolism in cancer
    100475291 (PIK3R2)
   05231 Choline metabolism in cancer
    100475291 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100475291 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100475291 (PIK3R2)
   05212 Pancreatic cancer
    100475291 (PIK3R2)
   05225 Hepatocellular carcinoma
    100475291 (PIK3R2)
   05226 Gastric cancer
    100475291 (PIK3R2)
   05214 Glioma
    100475291 (PIK3R2)
   05221 Acute myeloid leukemia
    100475291 (PIK3R2)
   05220 Chronic myeloid leukemia
    100475291 (PIK3R2)
   05218 Melanoma
    100475291 (PIK3R2)
   05211 Renal cell carcinoma
    100475291 (PIK3R2)
   05215 Prostate cancer
    100475291 (PIK3R2)
   05213 Endometrial cancer
    100475291 (PIK3R2)
   05224 Breast cancer
    100475291 (PIK3R2)
   05222 Small cell lung cancer
    100475291 (PIK3R2)
   05223 Non-small cell lung cancer
    100475291 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100475291 (PIK3R2)
   05017 Spinocerebellar ataxia
    100475291 (PIK3R2)
   05020 Prion disease
    100475291 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100475291 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100475291 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    100475291 (PIK3R2)
   04931 Insulin resistance
    100475291 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100475291 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100475291 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    100475291 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100475291 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    100475291 (PIK3R2)
   05161 Hepatitis B
    100475291 (PIK3R2)
   05160 Hepatitis C
    100475291 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    100475291 (PIK3R2)
   05164 Influenza A
    100475291 (PIK3R2)
   05162 Measles
    100475291 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    100475291 (PIK3R2)
   05163 Human cytomegalovirus infection
    100475291 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100475291 (PIK3R2)
   05169 Epstein-Barr virus infection
    100475291 (PIK3R2)
   05165 Human papillomavirus infection
    100475291 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100475291 (PIK3R2)
   05142 Chagas disease
    100475291 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100475291 (PIK3R2)
   01524 Platinum drug resistance
    100475291 (PIK3R2)
   01522 Endocrine resistance
    100475291 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100475291 (PIK3R2)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100475291 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 ATG11 Ribosomal_L22e Tai4 Mod_r
Other DBs
NCBI-GeneID: 100475291
NCBI-ProteinID: XP_019652903
LinkDB
Position
4
AA seq 473 aa
MLSRTSGPTHCTPLPPRTESSPDFPVLLVEKLLQEHLEEQEVAPPALPPKPPKAKPAPAG
LANGGNPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNN
KLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVK
EDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQG
QTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQASDNRE
IDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLP
HHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTAT
GFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPAAR
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgctttcccgtacatctggccctacccactgcactcccctcccccccaggactgagtcc
agccctgacttcccggtgctgctggtggagaagttgcttcaggaacatctggaggagcag
gaggtcgcacccccagctctgccgcctaaaccccccaaggcaaagcctgcccctgcaggc
ctggccaatggggggaacccaccctccctgcaggacgctgagtggtactggggtgacatc
tccagggaggaggtgaacgagaagctccgggacacgcctgatggcacctttctggtccga
gatgcatctagcaagatccagggggagtacacactgaccctcaggaaaggcgggaacaac
aagctgattaaagtcttccaccgcgacgggcactatggtttctcagaaccactcaccttc
tgctccgttgtggacctcatcacccactaccgccatgagtcgctggcccagtacaatgcc
aagctggacacccggctcctctacccagtgtccaagtaccagcaggaccagatcgtcaag
gaggacagcgtggaggcggtgggtgcccagctcaaagtctatcaccagcagtaccaggac
aagagccgcgagtatgaccagctgtatgaggagtacacccgcacctcccaggaactgcag
atgaagcgcacggcaattgaggccttcaatgagaccatcaagatctttgaagagcagggc
cagacgcaagagaagtgtagcaaggaatatctggagcgcttccgacgtgagggtaatgag
aaagagatgcagaggatcctgctgaactcagagcggctcaagtctcgcatcgctgaaatc
catgagagccgcacaaagctggagcaggagctgcgggcacaggcctcagacaaccgggag
atcgacaagcgcatgaacagcctcaagccagatctcatgcagctgcgcaagatccgagac
cagtaccttgtgtggcttacccagaaaggcgcccggcagaagaagatcaacgagtggttg
gggatcaaaaatgagactgaggaccagtacgcgctgatggaggatgaggatgacctcccc
caccatgaggaacgcacgtggtatgtgggcaagatcaaccgaacacaggctgaggaaatg
ctgagtggcaagcgggatggtaccttcctcatccgggagagcagccagcggggctgctac
gcctgctctgtggtggtggacggcgacacgaagcactgcgtcatttaccgcacggccaca
ggcttcggcttcgcggagccctacaacctgtacgggtcgctgaaggagctcgtgctgcat
taccagcacgcctcgctcgtgcagcacaacgatgcgctcacggtcacgctcgcccacccg
gtgcgcgcccccggccccggccccccgcccgccgcccgctga

KEGG   Ailuropoda melanoleuca (giant panda): 100479294
Entry
100479294         CDS       T01329                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05100  Bacterial invasion of epithelial cells
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05146  Amoebiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100479294 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100479294 (PIK3CA)
   04014 Ras signaling pathway
    100479294 (PIK3CA)
   04015 Rap1 signaling pathway
    100479294 (PIK3CA)
   04370 VEGF signaling pathway
    100479294 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100479294 (PIK3CA)
   04668 TNF signaling pathway
    100479294 (PIK3CA)
   04066 HIF-1 signaling pathway
    100479294 (PIK3CA)
   04068 FoxO signaling pathway
    100479294 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100479294 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100479294 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100479294 (PIK3CA)
   04024 cAMP signaling pathway
    100479294 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100479294 (PIK3CA)
   04152 AMPK signaling pathway
    100479294 (PIK3CA)
   04150 mTOR signaling pathway
    100479294 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100479294 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100479294 (PIK3CA)
   04218 Cellular senescence
    100479294 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100479294 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100479294 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100479294 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100479294 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    100479294 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100479294 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100479294 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100479294 (PIK3CA)
   04660 T cell receptor signaling pathway
    100479294 (PIK3CA)
   04662 B cell receptor signaling pathway
    100479294 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100479294 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100479294 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100479294 (PIK3CA)
   04062 Chemokine signaling pathway
    100479294 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100479294 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100479294 (PIK3CA)
   04929 GnRH secretion
    100479294 (PIK3CA)
   04915 Estrogen signaling pathway
    100479294 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100479294 (PIK3CA)
   04917 Prolactin signaling pathway
    100479294 (PIK3CA)
   04926 Relaxin signaling pathway
    100479294 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100479294 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100479294 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100479294 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100479294 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100479294 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100479294 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100479294 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100479294 (PIK3CA)
   04380 Osteoclast differentiation
    100479294 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100479294 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100479294 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479294 (PIK3CA)
   05206 MicroRNAs in cancer
    100479294 (PIK3CA)
   05205 Proteoglycans in cancer
    100479294 (PIK3CA)
   05203 Viral carcinogenesis
    100479294 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100479294 (PIK3CA)
   05231 Choline metabolism in cancer
    100479294 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100479294 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100479294 (PIK3CA)
   05212 Pancreatic cancer
    100479294 (PIK3CA)
   05225 Hepatocellular carcinoma
    100479294 (PIK3CA)
   05226 Gastric cancer
    100479294 (PIK3CA)
   05214 Glioma
    100479294 (PIK3CA)
   05221 Acute myeloid leukemia
    100479294 (PIK3CA)
   05220 Chronic myeloid leukemia
    100479294 (PIK3CA)
   05218 Melanoma
    100479294 (PIK3CA)
   05211 Renal cell carcinoma
    100479294 (PIK3CA)
   05215 Prostate cancer
    100479294 (PIK3CA)
   05213 Endometrial cancer
    100479294 (PIK3CA)
   05224 Breast cancer
    100479294 (PIK3CA)
   05222 Small cell lung cancer
    100479294 (PIK3CA)
   05223 Non-small cell lung cancer
    100479294 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100479294 (PIK3CA)
   05017 Spinocerebellar ataxia
    100479294 (PIK3CA)
   05020 Prion disease
    100479294 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100479294 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100479294 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100479294 (PIK3CA)
   04931 Insulin resistance
    100479294 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100479294 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100479294 (PIK3CA)
   05135 Yersinia infection
    100479294 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100479294 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479294 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100479294 (PIK3CA)
   05161 Hepatitis B
    100479294 (PIK3CA)
   05160 Hepatitis C
    100479294 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    100479294 (PIK3CA)
   05164 Influenza A
    100479294 (PIK3CA)
   05162 Measles
    100479294 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100479294 (PIK3CA)
   05163 Human cytomegalovirus infection
    100479294 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100479294 (PIK3CA)
   05169 Epstein-Barr virus infection
    100479294 (PIK3CA)
   05165 Human papillomavirus infection
    100479294 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100479294 (PIK3CA)
   05142 Chagas disease
    100479294 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100479294 (PIK3CA)
   01524 Platinum drug resistance
    100479294 (PIK3CA)
   01522 Endocrine resistance
    100479294 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100479294 (PIK3CA)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100479294 (PIK3CA)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100479294 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 100479294
NCBI-ProteinID: XP_034518479
Ensembl: ENSAMEG00000010753
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acattaataactataaagcatgaattatttaaagaagcaagaaagtaccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgagaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcctcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtgtctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactagaagtatgttgctgtcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttccttgaaaaataccctctaagtcagtataagtacataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactcccaactgccaatggac
tgtttcacaatgccttcatattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaatcctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
tatcatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctaaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctctgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaaccccatgcttagagttggagtttgactggttc
agcagtgtggtcaagttcccagatatgtcagtgattgaagagcatgccaactggtcggtg
tctcgggaagcaggatttagttattcccatgcaggactgagtaacagattagctagagac
aacgagttaagagaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaattgcttctgtccgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgtaattacccagatcccatggttcgaggttttgctgtccggtgcttggaa
aaatacttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaagtctgagatgcacaataaaaccgtt
agtcagcggtttggcctccttttggagtcctattgtcgtgcatgcgggatgtatttgaag
cacctaaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcagatgcgg
cgaccagatttcatggatgctctacaaggttttctgtctcctctaaatcctgctcatcaa
ttaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcagataattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaactcgcacacgattatgcagatt
cagtgcaaaggtggcctgaaaggtgctctgcagttcaatagccacacactccaccagtgg
ctcaaagacaagaacaaaggagaaatatacgatgcagccattgacctgttcacacgttca
tgtgctggatattgtgttgctactttcatattgggcattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Ailuropoda melanoleuca (giant panda): 100479580
Entry
100479580         CDS       T01329                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05100  Bacterial invasion of epithelial cells
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05146  Amoebiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100479580 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100479580 (PIK3CD)
   04014 Ras signaling pathway
    100479580 (PIK3CD)
   04015 Rap1 signaling pathway
    100479580 (PIK3CD)
   04370 VEGF signaling pathway
    100479580 (PIK3CD)
   04630 JAK-STAT signaling pathway
    100479580 (PIK3CD)
   04668 TNF signaling pathway
    100479580 (PIK3CD)
   04066 HIF-1 signaling pathway
    100479580 (PIK3CD)
   04068 FoxO signaling pathway
    100479580 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100479580 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100479580 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100479580 (PIK3CD)
   04024 cAMP signaling pathway
    100479580 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100479580 (PIK3CD)
   04152 AMPK signaling pathway
    100479580 (PIK3CD)
   04150 mTOR signaling pathway
    100479580 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100479580 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    100479580 (PIK3CD)
   04218 Cellular senescence
    100479580 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100479580 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100479580 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100479580 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100479580 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    100479580 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100479580 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100479580 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100479580 (PIK3CD)
   04660 T cell receptor signaling pathway
    100479580 (PIK3CD)
   04662 B cell receptor signaling pathway
    100479580 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100479580 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100479580 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100479580 (PIK3CD)
   04062 Chemokine signaling pathway
    100479580 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100479580 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    100479580 (PIK3CD)
   04929 GnRH secretion
    100479580 (PIK3CD)
   04915 Estrogen signaling pathway
    100479580 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100479580 (PIK3CD)
   04917 Prolactin signaling pathway
    100479580 (PIK3CD)
   04926 Relaxin signaling pathway
    100479580 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    100479580 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100479580 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100479580 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100479580 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    100479580 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100479580 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100479580 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    100479580 (PIK3CD)
   04380 Osteoclast differentiation
    100479580 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    100479580 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100479580 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479580 (PIK3CD)
   05206 MicroRNAs in cancer
    100479580 (PIK3CD)
   05205 Proteoglycans in cancer
    100479580 (PIK3CD)
   05203 Viral carcinogenesis
    100479580 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100479580 (PIK3CD)
   05231 Choline metabolism in cancer
    100479580 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100479580 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100479580 (PIK3CD)
   05212 Pancreatic cancer
    100479580 (PIK3CD)
   05225 Hepatocellular carcinoma
    100479580 (PIK3CD)
   05226 Gastric cancer
    100479580 (PIK3CD)
   05214 Glioma
    100479580 (PIK3CD)
   05221 Acute myeloid leukemia
    100479580 (PIK3CD)
   05220 Chronic myeloid leukemia
    100479580 (PIK3CD)
   05218 Melanoma
    100479580 (PIK3CD)
   05211 Renal cell carcinoma
    100479580 (PIK3CD)
   05215 Prostate cancer
    100479580 (PIK3CD)
   05213 Endometrial cancer
    100479580 (PIK3CD)
   05224 Breast cancer
    100479580 (PIK3CD)
   05222 Small cell lung cancer
    100479580 (PIK3CD)
   05223 Non-small cell lung cancer
    100479580 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100479580 (PIK3CD)
   05017 Spinocerebellar ataxia
    100479580 (PIK3CD)
   05020 Prion disease
    100479580 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100479580 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100479580 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    100479580 (PIK3CD)
   04931 Insulin resistance
    100479580 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100479580 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100479580 (PIK3CD)
   05135 Yersinia infection
    100479580 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    100479580 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479580 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    100479580 (PIK3CD)
   05161 Hepatitis B
    100479580 (PIK3CD)
   05160 Hepatitis C
    100479580 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    100479580 (PIK3CD)
   05164 Influenza A
    100479580 (PIK3CD)
   05162 Measles
    100479580 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    100479580 (PIK3CD)
   05163 Human cytomegalovirus infection
    100479580 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100479580 (PIK3CD)
   05169 Epstein-Barr virus infection
    100479580 (PIK3CD)
   05165 Human papillomavirus infection
    100479580 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100479580 (PIK3CD)
   05142 Chagas disease
    100479580 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100479580 (PIK3CD)
   01524 Platinum drug resistance
    100479580 (PIK3CD)
   01522 Endocrine resistance
    100479580 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100479580 (PIK3CD)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100479580 (PIK3CD)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100479580 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 100479580
NCBI-ProteinID: XP_034527073
Ensembl: ENSAMEG00000004036
LinkDB
Position
11
AA seq 1047 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLHDPEVNAFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRQEYLYGGYPLCQFQYICGCLHSGLTPHLTMVHSSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
YPVYYPTLDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLAARTLTGTSTAGSPQMLYLLGSWPELPVLSALELLDCSFPDRHVGSFAI
KSLRKLTDDELFRYLLQLVQVLKYESYLDCELAKFLLARALANRKIGHFLFWHLRSEMHV
PSVALRFGLIMEAYCRGSTHHMKVLVKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHV
CMRQETYLEALSNVQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGII
FKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANI
QLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSD
NIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFR
GYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRV
KFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3144 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gccgttgacttcctgttgcccacgggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgggcccagtatgagccactcttccac
atgctcagcgaccccgaggcctatgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgccagtgctgcgg
ctcgtggcccgagagggcgacagggtgaagaagctggtcaactctcagatcagcctcctc
atcggcaaaggcctccacgagttcgactccctgcatgacccagaagtgaatgccttccgc
accaagatgcgccagttctgtgaggaggcggccgcccggcggcagcagctgggctgggag
gcctggctacagtacagcttcccgctgcagctggagccctcggcgcggagctggggggcc
ggcaccctgagggtccccaaccgggccctcctggtcaacgtcaagttcgagggcagtgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcgtgcgcg
ctgcggaagaaggccaccgtgttccggcagcccctggtggagcagcccgaggactacaca
ctgcaggtgaacgggaggcaggagtacctgtacggcggctacccgctctgccagttccag
tacatctgcggctgcctgcacagcggcctgaccccccacctgaccatggtgcactcgtcc
tccatcctcgccatgcgggacgagcagagcgaccctgccccccaagtccagaaaccgcgc
accaaaccaccccccattcccatgaagaagccttcctccttgtccctgtggtccctggag
cagcctttctgcgtggagctgattcagggcagcaaagtgaatgccgatgagcggatgaag
ctggtcgtgcaggcggggctgttccacggcaacgagacgctgtgcaagacagtgtccagc
tcggaggtgagcgtgtgctcagagcccgtatggaaacagcggctggagtttgacatcaac
atctgtgacctgccccgcatggcccgtctctgctttgcactttacgccgtgatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcttgg
gccaacctcatgctgtttgactacaaggaccagctcaagaccggtgaatgctgcctgtac
atgtggccgtccgtcccagacgagaaaggggagctgctgaaccccacggggacagtgagg
agtaaccccaacacggagagcgctgcggccctcgtcatctgcctccccgaggtggccccc
taccctgtgtactaccccaccctggacaagattctggagctggggcggcacggggagcac
gggcgcttcagcgaggaagagcagctacagctgcgggaaatcctggagcggcgggggtcc
ggggagctgtacgagcacgagaaggacctggtgtggaagatgcggcacgaggtccaggag
cgcttccccgaggcgctggcccgcctgctgctggcggcccgcaccttgaccggcacctcg
accgctggctccccccagatgctctacctgctgggctcctggcccgagctgcccgtcctg
agcgccctggagctgctggactgcagcttccccgaccgccacgtgggctccttcgccatc
aagtctctgcggaagttgacggacgacgagctcttccggtacctgctgcagctggtgcag
gtgctcaagtacgagtcctacctcgactgcgagctggccaagttcctgctggcgcgggcc
ctggccaaccgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtg
ccgtccgtggctctgcgcttcggcctcatcatggaggcctactgccggggcagcacccac
cacatgaaggtgctcgtgaagcagggggaggcgctgagcaaactgaaggccctgaatgac
ttcgtcaaagtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacgtg
tgcatgcgtcaggagacctacctggaggccctctccaacgtgcagtccccgctggacccc
agcaccctgctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaag
cccttgtgggtcatgtacagcaacgaggaggcaggcagcgacggcagcgtgggcatcatc
tttaagaacggggacgacctccgccaggacatgctgactctgcagatgatccagctcatg
gatgttctgtggaagcaggagggactggacctgaggatgaccccctacggctgcctctcc
acgggggaccgcactggcctcatcgaggtggtgcttcactcagacaccatcgccaacatc
cagttgaacaaaagcaacatggcggccacagctgccttcaacaaggatgccctgctcaac
tggctcaagtccaagaaccctggggaggccttggatcgagccatcgaggagtttaccctc
tcctgtgccggctactgtgtggccacttacgtgctgggcatcggagatcggcacagcgac
aacatcatgatccgcgagaacgggcagctcttccacattgatttcggccactttctgggc
aacttcaagaccaagtttggaatcaaccgtgagcgagtcccgttcatcctcacgtatgac
tttgtgcacgtgatccagcaggggaaaacgaataacagtgagaaatttgaaaggttccgg
ggttactgtgagcgagcctacactatcctgaggcgccacgggctgctctttctccacctc
ttcgccctgatgcgggctgccggcctgcctgagctcagctgctccaaagacatccagtat
ctcaaggactctctggcgttgggaaagacggaggaggaggctctaaagcacttccgagtg
aagttcaacgaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaat
gtgtccaaagataacaggcaatag

KEGG   Ailuropoda melanoleuca (giant panda): 100483828
Entry
100483828         CDS       T01329                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05100  Bacterial invasion of epithelial cells
aml05135  Yersinia infection
aml05142  Chagas disease
aml05146  Amoebiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100483828 (PIK3R1)
   04014 Ras signaling pathway
    100483828 (PIK3R1)
   04015 Rap1 signaling pathway
    100483828 (PIK3R1)
   04370 VEGF signaling pathway
    100483828 (PIK3R1)
   04630 JAK-STAT signaling pathway
    100483828 (PIK3R1)
   04668 TNF signaling pathway
    100483828 (PIK3R1)
   04066 HIF-1 signaling pathway
    100483828 (PIK3R1)
   04068 FoxO signaling pathway
    100483828 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100483828 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100483828 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100483828 (PIK3R1)
   04024 cAMP signaling pathway
    100483828 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100483828 (PIK3R1)
   04152 AMPK signaling pathway
    100483828 (PIK3R1)
   04150 mTOR signaling pathway
    100483828 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100483828 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100483828 (PIK3R1)
   04218 Cellular senescence
    100483828 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100483828 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100483828 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100483828 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100483828 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    100483828 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100483828 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100483828 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100483828 (PIK3R1)
   04660 T cell receptor signaling pathway
    100483828 (PIK3R1)
   04662 B cell receptor signaling pathway
    100483828 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100483828 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100483828 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100483828 (PIK3R1)
   04062 Chemokine signaling pathway
    100483828 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100483828 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100483828 (PIK3R1)
   04929 GnRH secretion
    100483828 (PIK3R1)
   04915 Estrogen signaling pathway
    100483828 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100483828 (PIK3R1)
   04917 Prolactin signaling pathway
    100483828 (PIK3R1)
   04926 Relaxin signaling pathway
    100483828 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    100483828 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100483828 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100483828 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100483828 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100483828 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100483828 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100483828 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100483828 (PIK3R1)
   04380 Osteoclast differentiation
    100483828 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100483828 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100483828 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100483828 (PIK3R1)
   05206 MicroRNAs in cancer
    100483828 (PIK3R1)
   05205 Proteoglycans in cancer
    100483828 (PIK3R1)
   05203 Viral carcinogenesis
    100483828 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100483828 (PIK3R1)
   05231 Choline metabolism in cancer
    100483828 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100483828 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100483828 (PIK3R1)
   05212 Pancreatic cancer
    100483828 (PIK3R1)
   05225 Hepatocellular carcinoma
    100483828 (PIK3R1)
   05226 Gastric cancer
    100483828 (PIK3R1)
   05214 Glioma
    100483828 (PIK3R1)
   05221 Acute myeloid leukemia
    100483828 (PIK3R1)
   05220 Chronic myeloid leukemia
    100483828 (PIK3R1)
   05218 Melanoma
    100483828 (PIK3R1)
   05211 Renal cell carcinoma
    100483828 (PIK3R1)
   05215 Prostate cancer
    100483828 (PIK3R1)
   05213 Endometrial cancer
    100483828 (PIK3R1)
   05224 Breast cancer
    100483828 (PIK3R1)
   05222 Small cell lung cancer
    100483828 (PIK3R1)
   05223 Non-small cell lung cancer
    100483828 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100483828 (PIK3R1)
   05017 Spinocerebellar ataxia
    100483828 (PIK3R1)
   05020 Prion disease
    100483828 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100483828 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100483828 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    100483828 (PIK3R1)
   04931 Insulin resistance
    100483828 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100483828 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100483828 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    100483828 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100483828 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100483828 (PIK3R1)
   05161 Hepatitis B
    100483828 (PIK3R1)
   05160 Hepatitis C
    100483828 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    100483828 (PIK3R1)
   05164 Influenza A
    100483828 (PIK3R1)
   05162 Measles
    100483828 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100483828 (PIK3R1)
   05163 Human cytomegalovirus infection
    100483828 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100483828 (PIK3R1)
   05169 Epstein-Barr virus infection
    100483828 (PIK3R1)
   05165 Human papillomavirus infection
    100483828 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100483828 (PIK3R1)
   05142 Chagas disease
    100483828 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100483828 (PIK3R1)
   01524 Platinum drug resistance
    100483828 (PIK3R1)
   01522 Endocrine resistance
    100483828 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100483828 (PIK3R1)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100483828 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 AAA_13 SH3_2 DUF4201 Laminin_I Mod_r Lant_dehydr_C PI_PP_I
Other DBs
NCBI-GeneID: 100483828
NCBI-ProteinID: XP_002915929
Ensembl: ENSAMEG00000003039
LinkDB
Position
3
AA seq 725 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKAEADGEQQQALALPDLA
EQFAPPDIAPPLLVKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDV
QVLGDAFKRYLLDLPNPVIPVAVYSEMIYLAQEVQSSEEYIQLLKQLIGAPSIPHQHWLT
LQYLLKHFFKLSQASSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPATVANNGVSNSMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNAQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgagcgctgtatgattacaaaaaggaacgagaagaa
gatattgacttgcacttgggtgatgtcttgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggttataat
gaaaccaccggggaaagaggggactttccgggaacttacgttgaatatattggaaggaaa
aaaatctctcctcccacaccaaagccccgaccccctcgaccccttcctgttgcaccaggt
tcttcgaaagctgaagcagacggtgaacaacagcaagctttggcccttccagatcttgca
gagcagtttgcccctcccgacattgctccgcctcttcttgtgaagctagtggaagccatt
gaaaagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagca
gaattacgacagcttcttgattgtgatgccgcctccgtggacttggaaatgatcgatgtg
caagttttaggagacgctttcaaacgctatcttttggacttaccgaatcctgtcattcca
gtggccgtttacagtgaaatgatttatttagcccaagaagtacaaagctctgaagagtat
atccagctgctgaagcagctcatcggggcgcctagcatacctcatcagcactggcttacg
cttcagtatttgctaaagcatttcttcaagctctctcaagcctccagcaagaatcttctg
aatgcaagagtgctctctgaacttttcagtcctctgcttttcagattcccagcggccagc
tctgagaatactgaacacctcataaaagttatagaaattttaatctcaactgagtggaat
gaacgacagcctgcaccagcattgcctcctaaaccaccaaaacccgctactgtagccaac
aacggtgtgagtaacagcatgtccttacaagacgctgagtggtactggggagatatctca
agggaagaagtgaatgagaaacttcgagatacagctgacgggacctttttggtacgagac
gcatctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaa
ttaatcaaaatatttcaccgagatgggaaatatggcttctctgacccactgaccttcaac
tctgtggttgaactaataaaccactaccggaacgagtctctagctcagtataaccccaaa
ctggacgtgaagttactttatccagtatccaaataccaacaggatcaagttgtcaaagaa
gataatattgaagctgtagggaaaaaattacatgaatataatgctcaatttcaagaaaaa
agtcgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccaaatg
aaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaa
agccaggaacggtacagcaaagaatacatagaaaaatttaaacgtgaaggcaatgagaaa
gaaatacaaaggattatgcataattatgagaagttaaagtcccgaatcagtgaaattgtg
gacagcagacgacgactggaggaagacttgaagaagcaggcggctgagtaccgggagatt
gacaaacgcatgaacagcataaaaccagacctcatccagctgagaaagacgagagaccaa
tacttgatgtggctgactcagaaaggcgtccggcagaagaagctcaatgagtggctgggc
aatgagaacacggaagaccaatattcgctggtggaagatgatgaggatttgccgcaccac
gacgagaagacctggaacgtgggcagcagcaaccgaaacaaagcggagaacctgctccga
gggaaacgagacggcaccttcctggtccgggagagcagtaaacagggctgctacgcctgc
tctgtcgtggtggacggcgaagtcaagcattgtgtcatcaacaaaacggccaccggctat
ggcttcgccgagccctataacttgtacagctccctgaaagaactggtgctacattaccaa
cacacctccctcgtgcagcacaatgactcgctcaatgtcacactagcctacccggtatac
gcacagcagaggcgatga

DBGET integrated database retrieval system