KEGG   Ailuropoda melanoleuca (giant panda): 100465448
Entry
100465448         CDS       T01329                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04714  Thermogenesis
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04931  Insulin resistance
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml05016  Huntington disease
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100465448 (CREB3L3)
   04024 cAMP signaling pathway
    100465448 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    100465448 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    100465448 (CREB3L3)
   04152 AMPK signaling pathway
    100465448 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100465448 (CREB3L3)
   04922 Glucagon signaling pathway
    100465448 (CREB3L3)
   04915 Estrogen signaling pathway
    100465448 (CREB3L3)
   04926 Relaxin signaling pathway
    100465448 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    100465448 (CREB3L3)
   04918 Thyroid hormone synthesis
    100465448 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    100465448 (CREB3L3)
   04916 Melanogenesis
    100465448 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    100465448 (CREB3L3)
   04927 Cortisol synthesis and secretion
    100465448 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100465448 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100465448 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    100465448 (CREB3L3)
   04728 Dopaminergic synapse
    100465448 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    100465448 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100465448 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100465448 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100465448 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100465448 (CREB3L3)
   05020 Prion disease
    100465448 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    100465448 (CREB3L3)
   05031 Amphetamine addiction
    100465448 (CREB3L3)
   05034 Alcoholism
    100465448 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100465448 (CREB3L3)
   04934 Cushing syndrome
    100465448 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100465448 (CREB3L3)
   05161 Hepatitis B
    100465448 (CREB3L3)
   05163 Human cytomegalovirus infection
    100465448 (CREB3L3)
   05165 Human papillomavirus infection
    100465448 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100465448 (CREB3L3)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100465448 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF1664
Other DBs
NCBI-GeneID: 100465448
NCBI-ProteinID: XP_034513422
Ensembl: ENSAMEG00000002199
LinkDB
Position
4
AA seq 488 aa
MNGDLAAGKMASSTGPMDPIGSLELLDLLFDQQDGILRHVELGEAWDHVEDQQVLPGPDS
EDFLNSILASGDSAPSSPIWSPAASDSGISEDLPSDTQDTPPRSGMSATPTGCQTMEAGK
GLCPSYHPGPPCLASPPGPVAQVLEASVAIDLEMWSPSLCSEEQVEMADPPPSCNLTVKD
LLLSGSGAADLQQHHLAAPHLLCPGPEHGQELVLTEDEKKLLAKEGLTLPTQLPLTKYEE
RVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLE
QLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIVLPSISPFVAKKAENTGDYAPVRVFSR
TLHNNAASRVAPGATPGSEAPGPRSKDGISQEGSPGSPTADWESQGMSALDNLTKGLDNS
TLTPDNSTLVPDNSTLSRNNLTLIQDNSTLVSDNSTEKQNGATLLGWTAPEPALSSGRVG
LEAAGEEL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaatggggatttggcagctggaaagatggcttcctccaccggtcccatggaccccatc
ggcagcctggagctcctggacctcctgtttgatcagcaggacggcatcctgagacatgtg
gagctgggtgaggcctgggaccacgtcgaggaccagcaggtcctgccaggcccagactct
gaagatttcctaaactccatcctggcttctggagactcggcgcccagctccccgatctgg
tcccctgcagccagtgacagtggcatctctgaagacctgccctccgacacccaggacacc
cctccacgcagtgggatgtccgccacccccaccggctgccagactatggaggcaggcaag
gggctctgcccctcctaccatcctggacccccctgcctcgccagtccccctggaccggtg
gcccaagtactggaggcctctgtggccatagacctggaaatgtggagcccgagcctctgt
tctgaggaacaggttgagatggcggacccaccgccatcctgcaacctcactgtgaaagat
ctcctcctctccggcagcggtgccgcggacctgcagcagcatcacctggcggccccccac
ctgctgtgccccgggcctgagcacggccaggagctggtgctgacagaggatgagaagaag
cttctggccaaagaaggcctcacccttcccacccagctgcccctcaccaagtatgaggag
cgagtgctgaaaaaaatccgccggaaaatccggaacaaacagtctgcccaagaaagccgg
aaaaagaagaaggaatatattgatggcctggaaactcggatgtcagcctgcactgcccag
aaccaggagcttcagaggaaggtcttgcatctcgagaagcagaacctatccctcttggag
cagctgaagaaactccaggccattgtggtccagtccaccagcaagtcggcccagacgggc
acctgtgtagcggtcctgctgctctcctttgccctcatcgtcctgccctccattagccct
ttcgtcgccaaaaaagccgagaacaccggagactacgcacctgttcgagttttctccaga
actttgcacaacaacgctgcctcccgcgtggcccccggcgccacaccaggctccgaagcc
ccaggaccacggtccaaggacggcatatcccaggaagggtctccaggcagccccacagcg
gactgggaatctcagggcatgtcggctctggacaacttgacgaaggggctggacaactcg
accctgaccccagacaactccactctggtcccggacaactcgacactctcccggaacaat
ttgacactcatccaggacaactcgacgctcgtctcggacaactcgacggagaagcagaac
ggggccaccctgctgggctggactgcacctgagccagcgctcagctctgggcgggtgggc
ctggaggcagcaggggaggagctgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100470867
Entry
100470867         CDS       T01329                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04714  Thermogenesis
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04931  Insulin resistance
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml05016  Huntington disease
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100470867 (CREB3L1)
   04024 cAMP signaling pathway
    100470867 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    100470867 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    100470867 (CREB3L1)
   04152 AMPK signaling pathway
    100470867 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100470867 (CREB3L1)
   04922 Glucagon signaling pathway
    100470867 (CREB3L1)
   04915 Estrogen signaling pathway
    100470867 (CREB3L1)
   04926 Relaxin signaling pathway
    100470867 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    100470867 (CREB3L1)
   04918 Thyroid hormone synthesis
    100470867 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    100470867 (CREB3L1)
   04916 Melanogenesis
    100470867 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    100470867 (CREB3L1)
   04927 Cortisol synthesis and secretion
    100470867 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100470867 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100470867 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    100470867 (CREB3L1)
   04728 Dopaminergic synapse
    100470867 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    100470867 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100470867 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100470867 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100470867 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100470867 (CREB3L1)
   05020 Prion disease
    100470867 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    100470867 (CREB3L1)
   05031 Amphetamine addiction
    100470867 (CREB3L1)
   05034 Alcoholism
    100470867 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100470867 (CREB3L1)
   04934 Cushing syndrome
    100470867 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100470867 (CREB3L1)
   05161 Hepatitis B
    100470867 (CREB3L1)
   05163 Human cytomegalovirus infection
    100470867 (CREB3L1)
   05165 Human papillomavirus infection
    100470867 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100470867 (CREB3L1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100470867 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Spc29 Prominin TPR_MLP1_2 APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 100470867
NCBI-ProteinID: XP_002921663
Ensembl: ENSAMEG00000006633
LinkDB
Position
16
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQT
PVIKAEPQEVTQFLKVTPEDLVQMPLTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSSSQTVKEDPMATDSVYTASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGETAEPRPQDHLQHDHLDSSHETTK
YLSEAWPKDVGGNGTSPDFSHPKEWFRERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttcccagagcacctg
gaccactttgcggagaacatggaggacttctccaacgatctgttcagcagcttctttgat
gaccctgtgctggacgagaagagccctctactggacatggaactggactcccccacacca
ggcatccaggctgagcacagctactccctgagtggtgactcggcgcctcagagtcccctt
gtgcccatcaagatggaggacaccacccaagacgtggaacacggagcatgggtgctggga
cacaaactgtgctccgtcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggccgcctcttcagccatggccgcagctgccgccatggccaccactccgctgctgggc
ctcagccccctgtccaggctgcctgtcccccaccaggccccaggagagatgacgcagacg
ccagtgatcaaagcagagccccaggaggtgactcagttcctcaaagtgacaccagaggac
ctggtgcagatgcctctgacgccccccagcagccacggcagcgacagtgacggctcccag
agtccccgctctctgcccccctccagccctgtccggcccatggcccgctcctccacggcc
atctccacctccccccttctcaccgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaaacgcaccctgattgctgagggctaccccatccccacgaaa
ctccccctcaccaaagctgaagaaaaggccttaaagagggtccggagaaaaatcaagaat
aagatctcggcccaggagagccgccgtaagaagaaggagtatgtggaatgtctagaaaag
aaggtggagacgtttacatcagagaacaacgaactgtggaagaaggtagagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctcaagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgcttcgttctggtgctgggctccctcgtgccctgcctccctgagttctcctccagc
tcccagactgtgaaggaagaccccatggccacggacagtgtctacacagccagtcagatg
ccctcccgaagcctcctgttctacgacgagggggcaggctcgtgggaggatggccgcagt
gccctgctgcctgtggagcccccagatggctgggaaatcaagccgggggagacggccgag
cctcggccccaggatcacctgcagcatgaccacctggacagcagccatgagaccaccaag
tacctgagtgaggcctggccaaaagacgtcggtggaaacggcaccagccccgacttctct
caccccaaggagtggttccgtgagagggatctgggccccaataccaccatcaaactctcc
tag

KEGG   Ailuropoda melanoleuca (giant panda): 100472104
Entry
100472104         CDS       T01329                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04714  Thermogenesis
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04931  Insulin resistance
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml05016  Huntington disease
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100472104 (CREB3)
   04024 cAMP signaling pathway
    100472104 (CREB3)
   04022 cGMP-PKG signaling pathway
    100472104 (CREB3)
   04151 PI3K-Akt signaling pathway
    100472104 (CREB3)
   04152 AMPK signaling pathway
    100472104 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100472104 (CREB3)
   04922 Glucagon signaling pathway
    100472104 (CREB3)
   04915 Estrogen signaling pathway
    100472104 (CREB3)
   04926 Relaxin signaling pathway
    100472104 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    100472104 (CREB3)
   04918 Thyroid hormone synthesis
    100472104 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100472104 (CREB3)
   04916 Melanogenesis
    100472104 (CREB3)
   04925 Aldosterone synthesis and secretion
    100472104 (CREB3)
   04927 Cortisol synthesis and secretion
    100472104 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100472104 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100472104 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    100472104 (CREB3)
   04728 Dopaminergic synapse
    100472104 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    100472104 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100472104 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100472104 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100472104 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100472104 (CREB3)
   05020 Prion disease
    100472104 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    100472104 (CREB3)
   05031 Amphetamine addiction
    100472104 (CREB3)
   05034 Alcoholism
    100472104 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100472104 (CREB3)
   04934 Cushing syndrome
    100472104 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100472104 (CREB3)
   05161 Hepatitis B
    100472104 (CREB3)
   05163 Human cytomegalovirus infection
    100472104 (CREB3)
   05165 Human papillomavirus infection
    100472104 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100472104 (CREB3)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100472104 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100472104
NCBI-ProteinID: XP_002918928
Ensembl: ENSAMEG00000009744
UniProt: D2HAK8
LinkDB
Position
7
AA seq 352 aa
MELALDLGDQDLLDFLLEESGDLGAEQPLSEALSEWEAEDVLDSLLSPPTSLNVLSSSEP
CLVHHDHTYSLSQHVSIDLDGGNYGKEGAQTTPLRVEEPAEQEIARLILTDEEKRLLEKE
GLTLHGTLPLTKMEEQVLTRVRRKIRNKKSAQESRRKKKVYLGGLESRVLKYTAQNLELQ
NKVQLLEEQNLSLLDQLRRLQAMVIQISNKTSSSSTCVLVLLFSFCLLIVPAMYSSDTRG
SLPAEQGVLSRQLRALPSEDPHQLELPALQTEIPKDSSDQELQAPSNSCCLLYHMPQAPG
AEPPLKLPLPVLSSKPPCTGPILPLLANFTRDGGWLPTHSPTSVILQGRYSG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaactggcgttggacttgggtgaccaggacctgctggacttcctgctagaggaaagc
ggagatttgggggctgaacagccgctttccgaggcgctgagtgaatgggaggcagaggat
gtactggattccctgctgagtcccccaacatcgttgaacgtccttagctcctctgagccc
tgtcttgttcaccatgatcacacctactctctctcacaacatgtctccatagatctagat
ggtggtaactatggaaaagagggggcccagacgactccactgcgtgtggaggagccggca
gagcaggaaattgctaggctgatactgacagatgaggaaaagaggctgttggagaaggag
gggcttactctgcacgggacacttcctcttactaagatggaggagcaagttctgacacga
gtgcggaggaagattagaaacaaaaagtctgctcaagagagccgcaggaagaagaaggtg
tatttgggaggtttagagagcagggtcttgaaatacacagcccagaatctggagctacag
aacaaagtacagctcctggaggaacagaatttgtcccttctggaccagctgaggagactc
caggccatggtcattcagatatcgaacaaaacaagcagcagcagcacctgtgtcttggtc
ctacttttctccttctgtctgctcatcgtgcctgctatgtattcctctgacacaaggggg
agcctgccagctgagcagggagtgttgtcccgccagcttcgtgcccttcccagtgaggac
cctcaccagctggagctgcctgccctgcagacagagatacccaaggacagctcagaccag
gagctccaggctcctagcaactcttgctgcctgctctaccacatgccccaggctcctggt
gctgagcctcccctgaagttgccacttcctgtcctttcctcaaagcctccctgcacaggt
cccatccttcccctgcttgcaaatttcacaagagatgggggatggctccctactcacagc
cccacatctgttatcttacagggcagatattcaggctag

KEGG   Ailuropoda melanoleuca (giant panda): 100474135
Entry
100474135         CDS       T01329                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04714  Thermogenesis
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100474135 (ATF2)
   04668 TNF signaling pathway
    100474135 (ATF2)
   04022 cGMP-PKG signaling pathway
    100474135 (ATF2)
   04151 PI3K-Akt signaling pathway
    100474135 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100474135 (ATF2)
   04922 Glucagon signaling pathway
    100474135 (ATF2)
   04915 Estrogen signaling pathway
    100474135 (ATF2)
   04926 Relaxin signaling pathway
    100474135 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    100474135 (ATF2)
   04918 Thyroid hormone synthesis
    100474135 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    100474135 (ATF2)
   04925 Aldosterone synthesis and secretion
    100474135 (ATF2)
   04927 Cortisol synthesis and secretion
    100474135 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100474135 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100474135 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    100474135 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100474135 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100474135 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100474135 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    100474135 (ATF2)
   05031 Amphetamine addiction
    100474135 (ATF2)
   05034 Alcoholism
    100474135 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100474135 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100474135 (ATF2)
   05161 Hepatitis B
    100474135 (ATF2)
   05163 Human cytomegalovirus infection
    100474135 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100474135 (ATF2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100474135 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 100474135
NCBI-ProteinID: XP_002920284
Ensembl: ENSAMEG00000012333
UniProt: G1M0Z7
LinkDB
Position
2
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLAQM
ADQSTEPALSQIVMAPASQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agcaaaattgaggagccctctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaggtaccattggcacaaactgcacagcctaca
tcagctatcgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaagcggtaccttcgccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttctattgcat
ctccctaatggacagaccatgcctgttgctattcctgcatcaattacgagttctaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
attccaggtccttcctcccctcaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagc
gggttggttagaactcaatcagaggaatctcgaccacagtcattacaacagccagctaca
tccactacagaaactccggcttctccagctcacacgactccacagacccaaaatacaagt
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaagtttctagag
cgaaatagagcagcagcttcacgatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgccgacaaagatgatagttcagaagac
ctgtcagtgccaagtagtccacatacggaagctatacagcatagttctgtcagcacatcc
aatggagtcagttcgacctccaaggccgaggctgtggccacctcggtgctcgcgcagatg
gcggaccagagtacagagcctgcgctttcgcagattgttatggctcctgcctcccagtca
cagccctcaggaagttga

KEGG   Ailuropoda melanoleuca (giant panda): 100474261
Entry
100474261         CDS       T01329                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04714  Thermogenesis
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04931  Insulin resistance
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml05016  Huntington disease
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100474261 (CREB5)
   04024 cAMP signaling pathway
    100474261 (CREB5)
   04022 cGMP-PKG signaling pathway
    100474261 (CREB5)
   04151 PI3K-Akt signaling pathway
    100474261 (CREB5)
   04152 AMPK signaling pathway
    100474261 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100474261 (CREB5)
   04922 Glucagon signaling pathway
    100474261 (CREB5)
   04915 Estrogen signaling pathway
    100474261 (CREB5)
   04926 Relaxin signaling pathway
    100474261 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    100474261 (CREB5)
   04918 Thyroid hormone synthesis
    100474261 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    100474261 (CREB5)
   04925 Aldosterone synthesis and secretion
    100474261 (CREB5)
   04927 Cortisol synthesis and secretion
    100474261 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100474261 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100474261 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    100474261 (CREB5)
   04728 Dopaminergic synapse
    100474261 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    100474261 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100474261 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100474261 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    100474261 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100474261 (CREB5)
   05020 Prion disease
    100474261 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    100474261 (CREB5)
   05031 Amphetamine addiction
    100474261 (CREB5)
   05034 Alcoholism
    100474261 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100474261 (CREB5)
   04934 Cushing syndrome
    100474261 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100474261 (CREB5)
   05161 Hepatitis B
    100474261 (CREB5)
   05163 Human cytomegalovirus infection
    100474261 (CREB5)
   05165 Human papillomavirus infection
    100474261 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100474261 (CREB5)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100474261 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 Cnn_1N DivIC
Other DBs
NCBI-GeneID: 100474261
NCBI-ProteinID: XP_034525533
LinkDB
Position
1
AA seq 501 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFNELDCSLEHEFRKAQEEESSKRNISMHNTVGGAMAGPGAHQLGSTRMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGTMSTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHH
QQSHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPENSPPASPVPACSQQQVIQHNTITTSSAVSE
VVGSSTLSQLTAHRTDLNPIL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccatttgtctgcagtgccccgggctgctctcagcgcttc
ccaacagaggaccatctgatgattcataggcacaagcatgaaatgactttgaagttcccc
tcaataaaaacagacaatatgttatcagatcagactccgaccccaacgagattcctgaag
aactgcgaggaggtggggctcttcaatgagctggactgctccctcgagcatgagttcagg
aaggctcaggaggaggagagcagcaagcggaatatctcgatgcataacacagttggtggg
gccatggcggggcccggagctcaccagcttggcagcacccggatgcccaaccatgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctctgtcatcacacaggca
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctacatctc
cacaacagacagagacagcccatgccagcctccatgcctgggaccctacccaacccgacg
atgccgggatcttccgccgtcttgatgccaatggagagacagatgtcagtgaactccaac
ctcctgggaatgcaaggtccaaatctcagcaacccctgtgcttctccccaggtccagcca
atgcattcagaagccaaaatgaggttgaaggccgcgttgactcaccaccctgctgccatg
tcaaatgggactatgagcaccatgggacacatgatggaaatgatgggctcccggcaggac
cagacaccgcaccatcacatgcactcacacccgcatcagcaccagacactgccagcccat
cacccatacccacaccagcaccagcacccagcacaccaccctcacccgcagccccaccac
cagcagagccacccgcatcatcactcccactcccacctccacgcacaccctgcacatcac
cagacctcgccacacccgcccctgcactccggcaaccaagcacaggtctcaccagcaacg
caacagatgcagccaacccagacaatacagccaccccagcccacaggggggcgccggcga
agggtggtggacgaagatcccgacgagaggcggaggaaatttctggaacggaaccgggca
gctgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagca
gaggaactcacccagacgaacatgcagcttcagaatgaagtgtccatgttgaaaaatgag
gtggcacagctgaaacagttgttgttaacgcataaagactgtccaataacagccatgcag
aaagaatcacaaggatatctaagtcccgaaaacagccctcctgccagccccgtcccagct
tgctcccagcagcaggtcatccaacataataccatcaccacttcctccgccgtgagcgag
gtggtggggagctccactctcagtcagcttacggctcacagaacagacctgaaccccatc
ctttaa

KEGG   Ailuropoda melanoleuca (giant panda): 100476017
Entry
100476017         CDS       T01329                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04141  Protein processing in endoplasmic reticulum
aml04151  PI3K-Akt signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04918  Thyroid hormone synthesis
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100476017 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100476017 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100476017 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100476017 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100476017 (ATF6B)
   04915 Estrogen signaling pathway
    100476017 (ATF6B)
   04926 Relaxin signaling pathway
    100476017 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100476017 (ATF6B)
   04918 Thyroid hormone synthesis
    100476017 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100476017 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100476017 (ATF6B)
   04927 Cortisol synthesis and secretion
    100476017 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100476017 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100476017 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100476017 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100476017 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100476017 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100476017 (ATF6B)
   05031 Amphetamine addiction
    100476017 (ATF6B)
   05034 Alcoholism
    100476017 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100476017 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100476017 (ATF6B)
   05161 Hepatitis B
    100476017 (ATF6B)
   05163 Human cytomegalovirus infection
    100476017 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100476017 (ATF6B)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100476017 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 100476017
NCBI-ProteinID: XP_011235972
Ensembl: ENSAMEG00000002381
LinkDB
Position
5
AA seq 704 aa
MVGGRERKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYTGLDDVAEEQTQLFRCPEQD
VPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPPSQA
SGVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDEASDVQTKVEPVSPSSSIN
SEASLLSAESPTQAFIGEEVLEVKTESPSPQGCLLQDVLGPPLGGVQISMGPSSDGPLGK
ALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQPEGP
APPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCMMVFLLFIAFNFGPVS
ISEPPPAPISPRMSGEQPQPRRHLLEFSMQQPIQGVEPLQGSSLGPEEPQPSTPGRPSFR
NLTAFSGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQ
ERQKSQLRKKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQAHQPLYLNHP
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggttggggggcgggagagaaagatggcggaactgatgctcctcagcgagattgcggac
ccaacacgttttttcacggacaacttgctgagcccggaggactgggacagcaccttgtac
actggcctggatgatgtggcggaggagcagacgcagctcttccgctgcccagagcaggat
gtcccgtttggcagcagctccctggatgtggggatggatgtcagcccccctgagccgcct
tgggaccccctgcctatcttcccagatcttcaggtgaagtctgagccatcctccccctgc
tcctcttcctccctcagctccgaatcatcccatctttccacagagccccccagccaggct
tctggtgtaggagaggtgctggttgtgaagacagagtccttggcacccccactctgcctc
ctaggagatgacccaacatccccatttgaaactgtccagatcaatgtgggtcccacctct
gatgaagcctcagatgtccagaccaaggtagaacctgtctctccatcttcctccatcaac
tctgaggcttccctgctctcagcggagtcccccacccaggcttttataggagaggaggta
ctggaagtgaagacagagtcaccgtcccctcaagggtgtctcctgcaggatgtcctaggc
cccccacttggaggtgtccagatcagtatgggcccatcctctgatggccccttaggcaaa
gcccttcccacccggaagccacccctgcagcccaaacctgtggtgataaccaccgtcccg
atgccacccagagctgtgcctcccagcaccaccatccttttgcagccccttgtccagcca
cccccagtctccccagttgtcctcatccaaggtgctattcgggtccagcctgaggggccg
gcccccccggctccaaggcctgagaggaagagcattgttccagcccctatgcctgggaac
tcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaac
cgggagtcggcctgccagtcaaggaggaagaagaaggagtatctgcaggggctggaggct
cggctacaggccgtgctggccgacaaccagcagctccgccgggagaacgctgccctccgg
cggcggctggaggccctgctggctgagaacagcgagctcaagttagggtctggaaacagg
aaggtggtctgcatgatggtcttccttctcttcatcgccttcaactttggacccgtcagc
atcagcgagcctcctccggctcccatctctcctcggatgagcggagagcagcctcagccc
cggagacatttgctggagttctcaatgcaacagccaattcagggagttgaacccctccag
ggttcctccctgggccctgaggagccccagcccagcactccaggccggccaagtttcagg
aacctgacagccttctccgggggtgccaaggagttgctgctgagggacctggaccagctc
ttcctctcctctgactgccggcacttcaaccggaccgagtctctgaggcttgctgatgag
ctgagtggctgggtccagcgccaccagagaggccggcggaagattccccagagagcccag
gagagacagaagtctcagctacggaagaagtcgcctccagttaaggcagtccccacccaa
cccccggggcccccagagagggattctgtgggccagctgcagctgtatcgccacccagac
cgttcgcagccagagttcctggatgcaatcgaccgacgagaagacacgttttatgttgtg
tccttccgaagggaccacttgctgctccctgccatcagccacaacaagacctctcggccc
aagatgtccctggtgatgcctgccatggctcccaatgagaccctgtcaggccggggggcc
ccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgatt
cacatcaagacctccacggtgcccccctcactccgaaaacagccatcctcgaccccgggc
aatgccacaggtggccccttgccagcttcggcagccggccaggcccaccagcctctctac
ctcaatcacccctga

KEGG   Ailuropoda melanoleuca (giant panda): 100476284
Entry
100476284         CDS       T01329                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04137  Mitophagy - animal
aml04141  Protein processing in endoplasmic reticulum
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04915  Estrogen signaling pathway
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04932  Non-alcoholic fatty liver disease
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100476284 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100476284 (ATF4)
   04668 TNF signaling pathway
    100476284 (ATF4)
   04022 cGMP-PKG signaling pathway
    100476284 (ATF4)
   04151 PI3K-Akt signaling pathway
    100476284 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100476284 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    100476284 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100476284 (ATF4)
   04922 Glucagon signaling pathway
    100476284 (ATF4)
   04912 GnRH signaling pathway
    100476284 (ATF4)
   04915 Estrogen signaling pathway
    100476284 (ATF4)
   04926 Relaxin signaling pathway
    100476284 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    100476284 (ATF4)
   04918 Thyroid hormone synthesis
    100476284 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    100476284 (ATF4)
   04925 Aldosterone synthesis and secretion
    100476284 (ATF4)
   04927 Cortisol synthesis and secretion
    100476284 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100476284 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    100476284 (ATF4)
   04728 Dopaminergic synapse
    100476284 (ATF4)
   04720 Long-term potentiation
    100476284 (ATF4)
   04722 Neurotrophin signaling pathway
    100476284 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    100476284 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100476284 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100476284 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100476284 (ATF4)
   05012 Parkinson disease
    100476284 (ATF4)
   05014 Amyotrophic lateral sclerosis
    100476284 (ATF4)
   05020 Prion disease
    100476284 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    100476284 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    100476284 (ATF4)
   05031 Amphetamine addiction
    100476284 (ATF4)
   05034 Alcoholism
    100476284 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100476284 (ATF4)
   04934 Cushing syndrome
    100476284 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100476284 (ATF4)
   05161 Hepatitis B
    100476284 (ATF4)
   05163 Human cytomegalovirus infection
    100476284 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100476284 (ATF4)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100476284 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 MCU AAA_13 DUF3450 Nop53 bZIP_Maf Laminin_II
Other DBs
NCBI-GeneID: 100476284
NCBI-ProteinID: XP_002914604
UniProt: D2GZL3
LinkDB
Position
15
AA seq 351 aa
MAEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFDSLFSIDDLETMPDELLATLDDTC
DLFDPLVQETNKEPPQTVNPIGHLPESLPKTDQIAPFTFLQPLPLSPGALSSTPDHSFSL
ELGSEVDISEGDRKSDSTAYITVIPQCIKEEDAPSDNDSGICMSPESYLGSPQHSPSTSR
GSPNRSLLSPGSHCGSARPKPYDPPGEKSAAKVKVEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKAREKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgagatgagtttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaggagagcctgggtctcttagacgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcctcagacaacggcaaggaggatgccttctcc
gggacagattggatggtggagaaaatggatctgaaggagtttgattttgattctctgttt
agtatagatgacctggaaaccatgccagatgagcttttggccacgttggatgacacgtgt
gatctctttgaccccctagtccaggagacgaataaggagcccccccagaccgtgaaccca
attggccatctcccagaaagtttaccaaaaacagaccagattgccccctttaccttcctg
caaccacttccactttccccaggggccctgtcctccactccagatcattcctttagttta
gagctaggcagtgaagtggatatttctgaaggagatagaaagtcagactctactgcctac
attaccgtgatccctcagtgcataaaggaggaggatgccccctcagataatgacagtggc
atctgtatgagtcctgagtcctatctggggtccccccagcatagcccctctacctccagg
ggctctccaaataggagcctgctgtctccaggttcccactgtggttctgcccgccccaaa
ccctatgaccctcctggagagaagtcggcagcaaaagtaaaggtcgagaaactagacaag
aagctgaaaaagatggagcagaacaagactgcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcactggcgagtgtaaagagctggaaaagaagaacgaggctctg
aaagagagggcagattctttggctaaggagatccagtatctgaaagatttgatagaagag
gttcgaaaggcaagggagaagaaaagggtcccctag

KEGG   Ailuropoda melanoleuca (giant panda): 100477711
Entry
100477711         CDS       T01329                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04380  Osteoclast differentiation
aml04612  Antigen processing and presentation
aml04668  TNF signaling pathway
aml04710  Circadian rhythm
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04931  Insulin resistance
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml05016  Huntington disease
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100477711 (CREB1)
   04024 cAMP signaling pathway
    100477711 (CREB1)
   04022 cGMP-PKG signaling pathway
    100477711 (CREB1)
   04151 PI3K-Akt signaling pathway
    100477711 (CREB1)
   04152 AMPK signaling pathway
    100477711 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100477711 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    100477711 (CREB1)
   04922 Glucagon signaling pathway
    100477711 (CREB1)
   04915 Estrogen signaling pathway
    100477711 (CREB1)
   04926 Relaxin signaling pathway
    100477711 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    100477711 (CREB1)
   04918 Thyroid hormone synthesis
    100477711 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100477711 (CREB1)
   04916 Melanogenesis
    100477711 (CREB1)
   04924 Renin secretion
    100477711 (CREB1)
   04925 Aldosterone synthesis and secretion
    100477711 (CREB1)
   04927 Cortisol synthesis and secretion
    100477711 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100477711 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100477711 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    100477711 (CREB1)
   04728 Dopaminergic synapse
    100477711 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100477711 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    100477711 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100477711 (CREB1)
   04713 Circadian entrainment
    100477711 (CREB1)
   04714 Thermogenesis
    100477711 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100477711 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100477711 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100477711 (CREB1)
   05020 Prion disease
    100477711 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100477711 (CREB1)
   05031 Amphetamine addiction
    100477711 (CREB1)
   05034 Alcoholism
    100477711 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100477711 (CREB1)
   04934 Cushing syndrome
    100477711 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100477711 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100477711 (CREB1)
   05161 Hepatitis B
    100477711 (CREB1)
   05163 Human cytomegalovirus infection
    100477711 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477711 (CREB1)
   05165 Human papillomavirus infection
    100477711 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100477711 (CREB1)
   03029 Mitochondrial biogenesis [BR:aml03029]
    100477711 (CREB1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100477711 (CREB1)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100477711 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100477711
NCBI-ProteinID: XP_002918133
Ensembl: ENSAMEG00000015152
UniProt: D2H8G8
LinkDB
Position
2
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggcgttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaaacgaagagaaattctttcaaggagaccttcctacaggaaaattttgaatgac
ttatcttcagatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccaccgtaacggtgccaactccgatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtgcagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
atcctacagtatgcacagacaactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacagacatatcagattcgcacagcacccactagc
accatcgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgcctaatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaac
caaaataagacactcattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Ailuropoda melanoleuca (giant panda): 100483482
Entry
100483482         CDS       T01329                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04714  Thermogenesis
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04931  Insulin resistance
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml05016  Huntington disease
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100483482 (CREB3L2)
   04024 cAMP signaling pathway
    100483482 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    100483482 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    100483482 (CREB3L2)
   04152 AMPK signaling pathway
    100483482 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100483482 (CREB3L2)
   04922 Glucagon signaling pathway
    100483482 (CREB3L2)
   04915 Estrogen signaling pathway
    100483482 (CREB3L2)
   04926 Relaxin signaling pathway
    100483482 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    100483482 (CREB3L2)
   04918 Thyroid hormone synthesis
    100483482 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    100483482 (CREB3L2)
   04916 Melanogenesis
    100483482 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    100483482 (CREB3L2)
   04927 Cortisol synthesis and secretion
    100483482 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100483482 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100483482 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    100483482 (CREB3L2)
   04728 Dopaminergic synapse
    100483482 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    100483482 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100483482 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100483482 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100483482 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100483482 (CREB3L2)
   05020 Prion disease
    100483482 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    100483482 (CREB3L2)
   05031 Amphetamine addiction
    100483482 (CREB3L2)
   05034 Alcoholism
    100483482 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100483482 (CREB3L2)
   04934 Cushing syndrome
    100483482 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100483482 (CREB3L2)
   05161 Hepatitis B
    100483482 (CREB3L2)
   05163 Human cytomegalovirus infection
    100483482 (CREB3L2)
   05165 Human papillomavirus infection
    100483482 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100483482 (CREB3L2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100483482 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 100483482
NCBI-ProteinID: XP_002914247
Ensembl: ENSAMEG00000018046
UniProt: G1MI91
LinkDB
Position
1
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHVTTGDSVNDDEVESEKWYLSTDF
PSTTIKTEPITEEPPPGLVPSVTLTITAISTPFEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVEHLHLPPTPPSSHSSDSEGSLSPNPRLHPFGLPQTHSPARAVA
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSVQEPYT
ASVVRSRNLLIYEEHSPLEEPSSPASAGELGHWDRGSSLLRASGLETRPDVDLPHFIISN
DTSLEKSVLLELQQHLVNAKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggaaaccgaggctctcatgtaccacacgcacttctcagaactcctg
gatgagttttcccagaacgtgttgggtcagctcctgaatgacccttttctgtccgagaag
agcgtgtcgatggaggtggagccatccccaacatccccggcgcctctcatccaggccgag
cacagctactccctgtgtgaggagcctcgggcccagtcaccattcacccacgttaccacc
ggtgacagcgtcaatgacgatgaagtggaaagtgagaaatggtacctgtctacagacttt
ccatcaacaaccatcaagacagagccgattacagaggagccgcccccaggacttgtcccc
tctgtcactctgaccatcacagccatctctaccccttttgagaaggaggaaccccccctg
gaaatgaatactggggttgattcctcatgccagaccattattcctaagattaagctggag
ccccatgaagtggatcagttcctcaacttctctcctaaagaagcctccgtggaacacctg
cacttacctcccacccctcccagcagccacagcagcgactcagagggcagcctgagcccc
aacccccgcctgcacccctttggcctgcctcagacccacagccccgccagagccgtggca
cgggccccctcggccctgtccagctctcctctcctcacagcccctcataaactgcaagga
tcaggcccactggtcctgacagaggaggagaagaggaccctgatcgccgagggctatccc
atccccaccaaattgcctctaacaaaatcagaggagaaggctctgaagaaaattcggagg
aaaatcaagaacaagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcttggagaaaaaggtggagtcttgttcaactgagaatttggagcttcggaagaaggta
gaggttctggagaacaccaacagaactctcctacagcaactacagaagcttcagactttg
gtgatgggcaaggtttcgcgcacctgcaagttggcgggcacgcagactggcacgtgcctc
atggtggttgtgctatgctttgctgttgcatttggcagcttctttcagggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattctgtgcaggagccatataca
gcctctgtcgtgagatccaggaatctgctgatctacgaggagcattctcccctggaggag
ccgtccagcccagcctcggctggggagcttgggcattgggacagagggtcctctctgctc
agggcatcagggttggagaccaggcctgatgtggatcttccccatttcattatctcaaat
gacaccagcctggagaaatcagtgctgttggagcttcagcagcacttggtcaacgccaaa
ctggaggggaacgagacactaaaagttgtagaactcgacagaagagtgaacgccactttc
taa

KEGG   Ailuropoda melanoleuca (giant panda): 100484531
Entry
100484531         CDS       T01329                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04714  Thermogenesis
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04931  Insulin resistance
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml05016  Huntington disease
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100484531 (CREB3L4)
   04024 cAMP signaling pathway
    100484531 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    100484531 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    100484531 (CREB3L4)
   04152 AMPK signaling pathway
    100484531 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100484531 (CREB3L4)
   04922 Glucagon signaling pathway
    100484531 (CREB3L4)
   04915 Estrogen signaling pathway
    100484531 (CREB3L4)
   04926 Relaxin signaling pathway
    100484531 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    100484531 (CREB3L4)
   04918 Thyroid hormone synthesis
    100484531 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    100484531 (CREB3L4)
   04916 Melanogenesis
    100484531 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    100484531 (CREB3L4)
   04927 Cortisol synthesis and secretion
    100484531 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100484531 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100484531 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    100484531 (CREB3L4)
   04728 Dopaminergic synapse
    100484531 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    100484531 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    100484531 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100484531 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100484531 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100484531 (CREB3L4)
   05020 Prion disease
    100484531 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    100484531 (CREB3L4)
   05031 Amphetamine addiction
    100484531 (CREB3L4)
   05034 Alcoholism
    100484531 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100484531 (CREB3L4)
   04934 Cushing syndrome
    100484531 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100484531 (CREB3L4)
   05161 Hepatitis B
    100484531 (CREB3L4)
   05163 Human cytomegalovirus infection
    100484531 (CREB3L4)
   05165 Human papillomavirus infection
    100484531 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100484531 (CREB3L4)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100484531 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Jnk-SapK_ap_N JMY DUF4407 UPF0242 OmpH EMP24_GP25L DUF2514 APG6_N ZapB
Other DBs
NCBI-GeneID: 100484531
NCBI-ProteinID: XP_011227327
Ensembl: ENSAMEG00000011947
UniProt: D2HJP9
LinkDB
Position
8
AA seq 393 aa
MDFRTPDLLDVWLEPPEEVSTGAFLELGLHCPPPEVPGTKLQEQGLRGWGPSGSRGCGLR
ESEPEDFLKLLIDPNEVYCSEASPGSDSGISEDPGHPDSPSAPKAPSSPALYEVVYEAGG
LERVQGEAGPAVGLVSLQLDQRSPRLMVPDACTVHELPLAHAHTLPREGTVNPVPPATLL
PCQTLFLTEEEKRLLGQEGVSLPTHLPLTKAEERALKKVRRKIRNKQSAQDSRRRKKEYI
DGLETRAAACSAENQELQKKVQELEKHNISLVTQLRQLQRLIAQTSNKAAQTSTCVLILL
FSLALIILPSVSPLQGLREAGTEDHQPHGVISRNILTHKDMTENLETTVVESRLEGPLRA
KDVNGSTRTLLEKMGGKTGSSGHIRTVLHADEM
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggacttccgaacccccgacctgctggatgtgtggctggagcccccagaagaggtctcc
acaggagccttcctggagctgggactgcactgcccccctccagaggtcccagggactaag
ctccaagaacaggggcttcgaggctgggggcccagcgggagccgtggctgtggccttcga
gagagtgagcctgaagatttcctgaagcttctcattgatcccaatgaggtgtactgctcc
gaagcatctcctggcagtgacagcgggatctccgaggaccctggccatccagacagtcct
tctgcccccaaagcacccagttcccctgctctctatgaggttgtctatgaggcagggggc
ctggagagggtgcaaggggaagctgggccagccgtagggctcgtctctctccagctagat
cagcggagcccacgacttatggtgcctgatgcctgcacggtccacgagctgccccttgct
cacgctcacaccctgcccagagagggcactgtaaacccagtgcctcctgcaaccctactg
ccctgtcaaaccttgttcctgacagaggaagagaagcgtctgctgggacaggaaggggtt
tctctgcccactcatctgccgctcaccaaggcagaagagagggccctcaagaaggtcagg
aggaagatccgtaacaagcagtcagctcaggacagtcggcgacggaagaaagagtacatc
gacgggctagagactagggcggctgcctgttctgcagagaaccaggaactacagaaaaaa
gtccaggagctggagaaacacaatatctccctggtaactcagctccgccagctgcagagg
ctcattgcccaaacctccaacaaagctgcccagaccagcacttgtgttctgatccttctt
ttttctctggctctcatcatcctgcccagtgtcagccccttgcagggtctccgggaagct
gggactgaggatcaccagcctcatggagtgatttccagaaatatcctgactcacaaggac
atgacagaaaatttggagaccacagtggtagagtccagattagaggggccacttagggcc
aaggatgtaaatggttcaacaaggaccctgcttgagaagatgggaggcaagacaggttcc
agtgggcatatcagaacggtcctgcatgcagatgagatgtga

DBGET integrated database retrieval system