KEGG   Ailuropoda melanoleuca (giant panda): 100465700
Entry
100465700         CDS       T01329                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml04270  Vascular smooth muscle contraction
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04620  Toll-like receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100465700 (MAP2K2)
   04012 ErbB signaling pathway
    100465700 (MAP2K2)
   04014 Ras signaling pathway
    100465700 (MAP2K2)
   04015 Rap1 signaling pathway
    100465700 (MAP2K2)
   04370 VEGF signaling pathway
    100465700 (MAP2K2)
   04371 Apelin signaling pathway
    100465700 (MAP2K2)
   04066 HIF-1 signaling pathway
    100465700 (MAP2K2)
   04068 FoxO signaling pathway
    100465700 (MAP2K2)
   04072 Phospholipase D signaling pathway
    100465700 (MAP2K2)
   04071 Sphingolipid signaling pathway
    100465700 (MAP2K2)
   04024 cAMP signaling pathway
    100465700 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    100465700 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    100465700 (MAP2K2)
   04150 mTOR signaling pathway
    100465700 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100465700 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    100465700 (MAP2K2)
   04218 Cellular senescence
    100465700 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100465700 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100465700 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100465700 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100465700 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    100465700 (MAP2K2)
   04660 T cell receptor signaling pathway
    100465700 (MAP2K2)
   04662 B cell receptor signaling pathway
    100465700 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    100465700 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100465700 (MAP2K2)
   04929 GnRH secretion
    100465700 (MAP2K2)
   04912 GnRH signaling pathway
    100465700 (MAP2K2)
   04915 Estrogen signaling pathway
    100465700 (MAP2K2)
   04917 Prolactin signaling pathway
    100465700 (MAP2K2)
   04921 Oxytocin signaling pathway
    100465700 (MAP2K2)
   04926 Relaxin signaling pathway
    100465700 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    100465700 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    100465700 (MAP2K2)
   04916 Melanogenesis
    100465700 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100465700 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    100465700 (MAP2K2)
   04730 Long-term depression
    100465700 (MAP2K2)
   04722 Neurotrophin signaling pathway
    100465700 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100465700 (MAP2K2)
   05206 MicroRNAs in cancer
    100465700 (MAP2K2)
   05205 Proteoglycans in cancer
    100465700 (MAP2K2)
   05230 Central carbon metabolism in cancer
    100465700 (MAP2K2)
   05231 Choline metabolism in cancer
    100465700 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100465700 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100465700 (MAP2K2)
   05225 Hepatocellular carcinoma
    100465700 (MAP2K2)
   05226 Gastric cancer
    100465700 (MAP2K2)
   05214 Glioma
    100465700 (MAP2K2)
   05216 Thyroid cancer
    100465700 (MAP2K2)
   05221 Acute myeloid leukemia
    100465700 (MAP2K2)
   05220 Chronic myeloid leukemia
    100465700 (MAP2K2)
   05218 Melanoma
    100465700 (MAP2K2)
   05211 Renal cell carcinoma
    100465700 (MAP2K2)
   05219 Bladder cancer
    100465700 (MAP2K2)
   05215 Prostate cancer
    100465700 (MAP2K2)
   05213 Endometrial cancer
    100465700 (MAP2K2)
   05224 Breast cancer
    100465700 (MAP2K2)
   05223 Non-small cell lung cancer
    100465700 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100465700 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    100465700 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100465700 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100465700 (MAP2K2)
   05135 Yersinia infection
    100465700 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100465700 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    100465700 (MAP2K2)
   05161 Hepatitis B
    100465700 (MAP2K2)
   05160 Hepatitis C
    100465700 (MAP2K2)
   05164 Influenza A
    100465700 (MAP2K2)
   05163 Human cytomegalovirus infection
    100465700 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100465700 (MAP2K2)
   05165 Human papillomavirus infection
    100465700 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100465700 (MAP2K2)
   01522 Endocrine resistance
    100465700 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100465700 (MAP2K2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100465700 (MAP2K2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE7 family
   100465700 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 100465700
NCBI-ProteinID: XP_011234653
Ensembl: ENSAMEG00000002212
LinkDB
Position
4
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPVVDGVEGEPHSISPRPRP
PGRPISGHGTDSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADL
KMLMSHTFIKRSETEEVDFAGWLCNTLRLNQPSTPTRAAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcactatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccaaaagaag
ctagcggagctagaactcgacgagcagcagaagaagcgactggaagccttcctcacccag
aaggccaaggttggggagctcaaggacgatgacttcgaacggatctcggagctgggagcc
gggaacggcggggtggtcaccaaggtccagcacagaccttccggcctcatcatggcaaga
aagctgatccacctggaaatcaagccggctatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgtaactcgccgtacatcgtgggtttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggacggcggctctctggaccaggtgttgaaa
gaagccaagagaattcccgaggagatcctggggaaggtcagcattgcggttctccggggt
ttggcgtatctccgggaaaagcaccagatcatgcaccgagatgtgaaaccttccaacatc
ctcgtcaactcccgaggggagattaagctgtgcgattttggggtgagcggacagctcatc
gactccatggccaactccttcgtgggaactcggtcctacatgtctccagagcggttgcag
ggcactcactactctgtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccatcggaaggtaccccatccccccgccggacgccaaggagctagaggccatatttggc
cggcccgtggtggacggggtagaaggagagcctcacagcatctcaccacggccgagaccc
cctggacgccccatcagcggtcacgggacggacagccggccggccatggccatcttcgag
ctgctggactatatcgtgaacgagccacctcccaagctgcccagtggcgtcttcacccag
gacttccaggagtttgtaaataaatgcctaataaagaacccagcagagcgagcggatctg
aagatgctcatgagccacaccttcatcaagcggtccgagacggaagaagtggattttgcc
ggctggttgtgtaacacgctgcggctgaaccagcccagcacgcccacgcgcgctgccgtg
tga

KEGG   Ailuropoda melanoleuca (giant panda): 100478039
Entry
100478039         CDS       T01329                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml04270  Vascular smooth muscle contraction
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04540  Gap junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04620  Toll-like receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05034  Alcoholism
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100478039 (MAP2K1)
   04012 ErbB signaling pathway
    100478039 (MAP2K1)
   04014 Ras signaling pathway
    100478039 (MAP2K1)
   04015 Rap1 signaling pathway
    100478039 (MAP2K1)
   04370 VEGF signaling pathway
    100478039 (MAP2K1)
   04371 Apelin signaling pathway
    100478039 (MAP2K1)
   04668 TNF signaling pathway
    100478039 (MAP2K1)
   04066 HIF-1 signaling pathway
    100478039 (MAP2K1)
   04068 FoxO signaling pathway
    100478039 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100478039 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100478039 (MAP2K1)
   04024 cAMP signaling pathway
    100478039 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    100478039 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100478039 (MAP2K1)
   04150 mTOR signaling pathway
    100478039 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100478039 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100478039 (MAP2K1)
   04210 Apoptosis
    100478039 (MAP2K1)
   04218 Cellular senescence
    100478039 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100478039 (MAP2K1)
   04540 Gap junction
    100478039 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100478039 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100478039 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100478039 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100478039 (MAP2K1)
   04660 T cell receptor signaling pathway
    100478039 (MAP2K1)
   04662 B cell receptor signaling pathway
    100478039 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100478039 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100478039 (MAP2K1)
   04062 Chemokine signaling pathway
    100478039 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100478039 (MAP2K1)
   04929 GnRH secretion
    100478039 (MAP2K1)
   04912 GnRH signaling pathway
    100478039 (MAP2K1)
   04915 Estrogen signaling pathway
    100478039 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100478039 (MAP2K1)
   04917 Prolactin signaling pathway
    100478039 (MAP2K1)
   04921 Oxytocin signaling pathway
    100478039 (MAP2K1)
   04926 Relaxin signaling pathway
    100478039 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    100478039 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100478039 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100478039 (MAP2K1)
   04916 Melanogenesis
    100478039 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100478039 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    100478039 (MAP2K1)
   04726 Serotonergic synapse
    100478039 (MAP2K1)
   04720 Long-term potentiation
    100478039 (MAP2K1)
   04730 Long-term depression
    100478039 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100478039 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100478039 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100478039 (MAP2K1)
   05206 MicroRNAs in cancer
    100478039 (MAP2K1)
   05205 Proteoglycans in cancer
    100478039 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100478039 (MAP2K1)
   05231 Choline metabolism in cancer
    100478039 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100478039 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100478039 (MAP2K1)
   05212 Pancreatic cancer
    100478039 (MAP2K1)
   05225 Hepatocellular carcinoma
    100478039 (MAP2K1)
   05226 Gastric cancer
    100478039 (MAP2K1)
   05214 Glioma
    100478039 (MAP2K1)
   05216 Thyroid cancer
    100478039 (MAP2K1)
   05221 Acute myeloid leukemia
    100478039 (MAP2K1)
   05220 Chronic myeloid leukemia
    100478039 (MAP2K1)
   05218 Melanoma
    100478039 (MAP2K1)
   05211 Renal cell carcinoma
    100478039 (MAP2K1)
   05219 Bladder cancer
    100478039 (MAP2K1)
   05215 Prostate cancer
    100478039 (MAP2K1)
   05213 Endometrial cancer
    100478039 (MAP2K1)
   05224 Breast cancer
    100478039 (MAP2K1)
   05223 Non-small cell lung cancer
    100478039 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100478039 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    100478039 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    100478039 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100478039 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100478039 (MAP2K1)
   05135 Yersinia infection
    100478039 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100478039 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    100478039 (MAP2K1)
   05161 Hepatitis B
    100478039 (MAP2K1)
   05160 Hepatitis C
    100478039 (MAP2K1)
   05164 Influenza A
    100478039 (MAP2K1)
   05163 Human cytomegalovirus infection
    100478039 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100478039 (MAP2K1)
   05165 Human papillomavirus infection
    100478039 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100478039 (MAP2K1)
   01522 Endocrine resistance
    100478039 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100478039 (MAP2K1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100478039 (MAP2K1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE7 family
   100478039 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 100478039
NCBI-ProteinID: XP_011216791
Ensembl: ENSAMEG00000003218
UniProt: D2GYT9
LinkDB
Position
5
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLAELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNVLVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDGEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggcggagctg
gagctcgatgagcagcagcggaagcgcctggaggccttcctcacccagaagcagaaggtc
ggggaattgaaggatgacgacttcgagaagatcagtgagctgggcgctggcaacggtggt
gtggtgttcaaggtctcccacaagccctccggcctggtcatggccagaaagctgattcac
ctggagatcaaacctgccatccggaatcagatcataagggagctgcaggttctgcacgag
tgcaactcgccctacatcgtgggcttctatggtgccttctacagcgacggcgagatcagt
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggtctgacttacctg
agggagaagcacaagattatgcacagagatgtcaagccttccaacgtcctcgtgaactcc
cgtggggagatcaagctctgtgactttggggtcagtggacagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtggggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaagtggag
ggagatgcggctgagacaccacccagaccaaggacccccggaaggcccctcagctcttat
ggaatggatagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccaaaactgcccagtggagttttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatctgaagcaactcatggttcatgccttc
atcaagagatcggacggggaagaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacaccgacccacgcagccggcgtctaa

DBGET integrated database retrieval system