KEGG   Ailuropoda melanoleuca (giant panda): 100466374
Entry
100466374         CDS       T01329                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain isoform X2
  KO
K06751  MHC class I antigen
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04144  Endocytosis
aml04145  Phagosome
aml04218  Cellular senescence
aml04514  Cell adhesion molecules
aml04612  Antigen processing and presentation
aml04940  Type I diabetes mellitus
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
aml05320  Autoimmune thyroid disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100466374
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100466374
   04145 Phagosome
    100466374
  09143 Cell growth and death
   04218 Cellular senescence
    100466374
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100466374
   04612 Antigen processing and presentation
    100466374
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100466374
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100466374
   05330 Allograft rejection
    100466374
   05332 Graft-versus-host disease
    100466374
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100466374
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100466374
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100466374
   05170 Human immunodeficiency virus 1 infection
    100466374
   05168 Herpes simplex virus 1 infection
    100466374
   05163 Human cytomegalovirus infection
    100466374
   05167 Kaposi sarcoma-associated herpesvirus infection
    100466374
   05169 Epstein-Barr virus infection
    100466374
   05165 Human papillomavirus infection
    100466374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100466374
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
    100466374
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100466374
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
 Antigens
  100466374
SSDB
Motif
Pfam: MHC_I C1-set ig MHC_I_3 C2-set_2
Other DBs
NCBI-GeneID: 100466374
NCBI-ProteinID: XP_011215889
LinkDB
Position
3
AA seq 392 aa
MLLLLQLLGLVPERAAESPWGLPLVADGPASLAKVVMAELANLKLGNKPWPGGTHSLHYH
YLAVSEPGPGLPQFLAVGYVDDQPFIHYDSCVDRAKPQAPWMATVDAQYWETETQKQRTW
AKVQQVETWTVMGYHNRSSGMHSTQRMFGCEIREDGRTSSFWQFGFDGQDHVSLDLETLS
WVSAKPAAVRTKRWWETERCYAEYDKAYLEGLCLISLHRYLELGGWSLTRKEPPTVQVTR
HTAQDGGITLKCWARGFYPRDISLSWWLGEEELVLETEYVETRPSGDGTYQTWAAVRVPA
RKEDWYTCHVQHSGLNHTLTVAWEAPSRQWKTSAVVVSTIFTITFLLMAGVRIFIKQYSQ
ARNKESCKQAPGGEDPQNSQSPATVEATQLFC
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctgctgctcctgcagctgttgggtctagtgccggagcgcgcggcagagagtccctgg
gggctgcctttggtggccgatggcccagcttccttagcgaaggtggtgatggcagaacta
gccaacctgaagttaggaaacaaaccatggcctggagggacgcactctctccactaccac
tacctggccgtgtcagagccaggcccgggccttccccagtttctggccgtaggctacgtg
gacgaccagcccttcatccattacgacagttgtgtggacagggccaagccccaggcccca
tggatggcaaccgtggacgcccagtactgggagacagagacccagaagcagaggacctgg
gcaaaggtgcagcaggtggagacgtggaccgtgatgggctaccacaaccgcagcagtggc
atgcacagcactcagcggatgttcggctgtgagatccgggaggacggccgtaccagcagc
ttctggcagtttggctttgatgggcaggaccacgtgtcactggacctggagactctgagc
tgggtgtcagccaaacctgcggccgtacggaccaagcgctggtgggagacagagcgctgc
tatgctgagtatgacaaggcctacctggaaggcctctgcctcatttccctgcacaggtac
ctggagctgggaggctggagcctcactcggaaagagccgcccacagtgcaggtgacaaga
cacacagcccaggatggaggcatcaccctgaaatgttgggcccggggcttctacccacgg
gatatctcattgagctggtggctgggtgaggaggagctggttctagagactgagtacgtg
gagacacgccccagtggagatggcacctaccagacatgggcggccgtgcgggtgccggcc
aggaaggaggactggtacacttgccacgtgcagcactctggcctgaaccatacgctcact
gtggcctgggaagcaccctctcgtcagtggaaaaccagtgctgtggttgtctccactatc
ttcaccatcactttcttgctgatggctggagtgcggatcttcatcaagcagtactctcaa
gccaggaataaggaatcttgcaaacaagccccaggtggagaggaccctcagaattcccaa
agcccagcgacagtggaggccactcagctgttctgctga

KEGG   Ailuropoda melanoleuca (giant panda): 100470568
Entry
100470568         CDS       T01329                                 

Gene name
AIME-128
Definition
(RefSeq) DLA class I histocompatibility antigen, A9/A9 alpha chain
  KO
K06751  MHC class I antigen
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04144  Endocytosis
aml04145  Phagosome
aml04218  Cellular senescence
aml04514  Cell adhesion molecules
aml04612  Antigen processing and presentation
aml04940  Type I diabetes mellitus
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
aml05320  Autoimmune thyroid disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100470568 (AIME-128)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100470568 (AIME-128)
   04145 Phagosome
    100470568 (AIME-128)
  09143 Cell growth and death
   04218 Cellular senescence
    100470568 (AIME-128)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100470568 (AIME-128)
   04612 Antigen processing and presentation
    100470568 (AIME-128)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100470568 (AIME-128)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100470568 (AIME-128)
   05330 Allograft rejection
    100470568 (AIME-128)
   05332 Graft-versus-host disease
    100470568 (AIME-128)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100470568 (AIME-128)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100470568 (AIME-128)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100470568 (AIME-128)
   05170 Human immunodeficiency virus 1 infection
    100470568 (AIME-128)
   05168 Herpes simplex virus 1 infection
    100470568 (AIME-128)
   05163 Human cytomegalovirus infection
    100470568 (AIME-128)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100470568 (AIME-128)
   05169 Epstein-Barr virus infection
    100470568 (AIME-128)
   05165 Human papillomavirus infection
    100470568 (AIME-128)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100470568 (AIME-128)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
    100470568 (AIME-128)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100470568 (AIME-128)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
 Antigens
  100470568 (AIME-128)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2 MHC_I_3 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 100470568
NCBI-ProteinID: XP_034516350
LinkDB
Position
5
AA seq 364 aa
MQVVMTRTLVLLLSGALAVTETWAGSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRF
DSDSASRRMEPRAPWIEQEGPEYWDRNTRIAKDNAQAFRVDLQTALRYYNQSEAGSHTIQ
WMHGCDVGPDGRLLRGYSQLAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGEAERY
RNYVEGECVEWLRRYLENGKETLQRAETPDTRVTRHPISDQKVTLRCWALGFYPAEITLT
WQQDGEDLTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPEPLTRSWEP
PPQPTITVPITCIIAGLVLLTVTVGIGAVIRRRRHSGGKGPSYSHAARDDSAQGSDVSLT
VPKV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcaggtcgtgatgacccgaactctcgtcctgctgctgtcgggggccctggccgtgacc
gagacctgggcgggctcgcactccatgaggtatttctacaccgcggtgtcccggcccggc
cgcggggagccccgcttcatcgccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgactctgccagtcggaggatggagccgcgggcgccgtggattgagcaggagggg
ccggagtattgggaccggaacacgcggatcgccaaggacaacgcacaggctttccgagtg
gacttgcagaccgccctccgctactacaaccagagcgaggccggctctcacaccatccag
tggatgcacggctgtgacgtggggccggacggccgcctcctccgcgggtacagtcagtta
gcctacgatggcgcggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacacggcggcacagatcacccggcgcaagtgggaggcggccggtgaggcagagcgttac
aggaactacgtggagggagagtgcgtggagtggctccgcaggtacctggagaacgggaag
gagacgctgcagcgcgcagaaaccccggacacacgtgtgacccgtcaccccatctctgac
caaaaggtcacgctgaggtgctgggccctgggcttctaccctgcggagatcaccctgacc
tggcagcaggatggggaggacctgacccaggacacggagcttgtggagaccaggccagca
ggagatgggaccttccagaagtgggcggctgtggtggtgccttccggacaggagcagaga
tacacgtgccatgtgcagcacgaggggctgcccgagcccctcacacggagttgggagccg
cctcctcagcccaccatcaccgtccccatcacgtgtatcatcgctggtctggttctcctt
acggtcactgtggggattggagctgtgatccggaggaggaggcactcgggaggaaaagga
ccgagttactctcacgctgcacgcgatgacagtgcccagggctctgatgtgtctcttaca
gttcctaaagtatga

KEGG   Ailuropoda melanoleuca (giant panda): 100476691
Entry
100476691         CDS       T01329                                 

Gene name
AIME-152
Definition
(RefSeq) class I histocompatibility antigen, Aime-152 precursor
  KO
K06751  MHC class I antigen
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04144  Endocytosis
aml04145  Phagosome
aml04218  Cellular senescence
aml04514  Cell adhesion molecules
aml04612  Antigen processing and presentation
aml04940  Type I diabetes mellitus
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
aml05320  Autoimmune thyroid disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100476691 (AIME-152)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100476691 (AIME-152)
   04145 Phagosome
    100476691 (AIME-152)
  09143 Cell growth and death
   04218 Cellular senescence
    100476691 (AIME-152)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100476691 (AIME-152)
   04612 Antigen processing and presentation
    100476691 (AIME-152)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100476691 (AIME-152)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100476691 (AIME-152)
   05330 Allograft rejection
    100476691 (AIME-152)
   05332 Graft-versus-host disease
    100476691 (AIME-152)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100476691 (AIME-152)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100476691 (AIME-152)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100476691 (AIME-152)
   05170 Human immunodeficiency virus 1 infection
    100476691 (AIME-152)
   05168 Herpes simplex virus 1 infection
    100476691 (AIME-152)
   05163 Human cytomegalovirus infection
    100476691 (AIME-152)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100476691 (AIME-152)
   05169 Epstein-Barr virus infection
    100476691 (AIME-152)
   05165 Human papillomavirus infection
    100476691 (AIME-152)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100476691 (AIME-152)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
    100476691 (AIME-152)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100476691 (AIME-152)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
 Antigens
  100476691 (AIME-152)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2 MATalpha_HMGbox EphA2_TM
Other DBs
NCBI-GeneID: 100476691
NCBI-ProteinID: NP_001291774
Ensembl: ENSAMEG00000001714
UniProt: B2KT51
LinkDB
AA seq 364 aa
MSNLLRRTLVLLLSGALAVTETWAGSHSLRYFHTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDSASRRAEPRAPWMEQEGPEYWDRETRNAKDNAQTFRLDLNNLLGYYNQSEAGSHTIQ
WMHGCDVGPDGRLLRGYEQFAYDGADYIALNEDLRSWTAADTAAQITRSRWEAAGDAEHD
RNYVECTCVEWLRRYLENGKETLQRAETPNTHVTRHPISDQRVSLRCWALGFYPAEITLT
WQQDGEDLTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPEPLTLRWQP
PPQPTITVPITWIIAGLVLLTVTVVIGAVIWRRKRSGGKGPSYSHAARDDSARGSNVSLT
VPIV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtccaacctgctgcgccgaaccctcgtcctgctgctgtcgggggccctggccgtgacc
gagacctgggcgggctcgcactccctgaggtatttccacaccgcggtgtcccggcccggc
cgcggggagccccgcttcatctccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgactctgccagtcggagggccgagccgcgggcgccgtggatggagcaggagggg
cccgagtattgggaccgggagacgcggaatgccaaggacaacgcacagactttccgactg
gacctgaacaacctgctgggctactacaaccagagcgaggccggctctcacaccatccag
tggatgcacggctgtgacgtggggccggacggccgcctcctccgcggttatgagcagttc
gcctatgatggcgcggattacatcgccctgaacgaggacctgcgctcctggaccgcagcg
gacacagcggcgcagatcacccggagcaggtgggaggcagcaggtgatgcagagcacgac
aggaactacgtggagtgcacctgcgtggagtggctccgcaggtacctggagaacgggaag
gagacgctgcagcgcgcagaaacccctaatacacacgtgacccgccatcccatctctgac
caaagggtcagcctgaggtgctgggccctgggcttctaccctgcggagatcaccctgacc
tggcagcaggatggggaggacctgacccaggacacggagcttgtggagaccaggcctgca
ggagatgggaccttccagaagtgggcagctgtggtggtgccttccggacaggagcagaga
tacacgtgccatgtgcagcatgaggggctgcccgagcccctcacactgagatggcagccg
cctcctcagcccaccatcactgtccccatcacgtggatcatcgctggtctggttctcctt
acggtcactgtggtgattggagctgtgatctggaggagaaagcgctcaggaggaaaagga
ccgagttactctcacgctgcacgcgatgacagtgcccggggctctaatgtgtctcttacg
gttcctatagtgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100483904
Entry
100483904         CDS       T01329                                 

Gene name
AIME-1906
Definition
(RefSeq) class I histocompatibility antigen, Gogo-OKO alpha chain
  KO
K06751  MHC class I antigen
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04144  Endocytosis
aml04145  Phagosome
aml04218  Cellular senescence
aml04514  Cell adhesion molecules
aml04612  Antigen processing and presentation
aml04940  Type I diabetes mellitus
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
aml05320  Autoimmune thyroid disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100483904 (AIME-1906)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100483904 (AIME-1906)
   04145 Phagosome
    100483904 (AIME-1906)
  09143 Cell growth and death
   04218 Cellular senescence
    100483904 (AIME-1906)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100483904 (AIME-1906)
   04612 Antigen processing and presentation
    100483904 (AIME-1906)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100483904 (AIME-1906)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100483904 (AIME-1906)
   05330 Allograft rejection
    100483904 (AIME-1906)
   05332 Graft-versus-host disease
    100483904 (AIME-1906)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100483904 (AIME-1906)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100483904 (AIME-1906)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100483904 (AIME-1906)
   05170 Human immunodeficiency virus 1 infection
    100483904 (AIME-1906)
   05168 Herpes simplex virus 1 infection
    100483904 (AIME-1906)
   05163 Human cytomegalovirus infection
    100483904 (AIME-1906)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100483904 (AIME-1906)
   05169 Epstein-Barr virus infection
    100483904 (AIME-1906)
   05165 Human papillomavirus infection
    100483904 (AIME-1906)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100483904 (AIME-1906)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
    100483904 (AIME-1906)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100483904 (AIME-1906)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
 Antigens
  100483904 (AIME-1906)
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 Ig_3 MHC_I_C MATalpha_HMGbox
Other DBs
NCBI-GeneID: 100483904
NCBI-ProteinID: XP_034509047
Ensembl: ENSAMEG00000002302
LinkDB
Position
Unknown
AA seq 355 aa
MWMAVSRPRTLLLLLLSGALTLTKTSAGSHSLRYFRTVISRPGNAESRYLEVGYVDDTQF
VRFDSDGTSPRAELRAPWLEQEGPEFWDWKTQNTRTCTQILRGRLNEVRGYYNESEEGSH
TFQSMVGCDMGPDGRFLRGYFRNAYDGADYITLNEDLRSWTAANSEAQITRRMWEASGVA
QRSRNYLEGLCMEWLRRHLENGKETLQRSESPKRQVTRHPISDREVTLRCWALGFYPAEI
TLTWQRDGEDQNQNIESVETRPAGDGTFQKWAAVVVPSGEEQRYTCHIQHKALPEPLTLR
WEPPPQPTIPIMGIIAGLVLLVVTGAVVAGATMWRKKHAGGKGGSYSQAESSDSA
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgtggatggcggtcagccgtccccgaaccctcctcctgctgctactgtcgggggccctg
accctgaccaagaccagcgccggctcccactccctcaggtatttccgcacggtcatatcc
cgacctggcaatgcggagtcccggtacttggaggtcggctacgtggacgacacgcagttc
gtgcggttcgacagcgacggcacgagtccgagggctgagctgcgggcgccgtggttggag
caggaggggccggagttttgggactggaagacgcagaacaccaggacctgcacacagatt
ctccgagggaggctgaacgaagtgcggggctactacaacgagagcgaggaagggtctcac
accttccagagtatggtaggctgcgacatggggcctgatggacgcttcctccgcgggtac
ttccgtaacgcctatgatggcgcggattacatcaccctgaatgaggacctgcgctcctgg
accgctgcgaactcggaggcgcagatcaccagacgcatgtgggaggcatctggtgtagcc
cagaggagtcggaactacttggagggcttgtgcatggagtggctccgcaggcacctggag
aatgggaaggaaacgctgcagcgctcagaatcccccaaaagacaagtgacccgccatccc
atctctgaccgtgaggtcaccctgaggtgctgggctctggggttctaccctgcggaaatc
accctgacctggcagcgagatggggaagaccagaaccagaacatagagtctgtggagacc
aggcctgcaggagatgggaccttccagaagtgggcggctgtggtggtaccttctggagag
gaacagagatacacatgccatatacagcacaaggcactgcccgagcccctcaccttgaga
tgggagccacctcctcagcccaccatccccatcatgggcatcattgctggcctggttctc
cttgtggtcactggagctgtggtggctggagctacgatgtggaggaagaagcacgcaggt
ggaaaaggagggagctactcacaggctgaaagcagtgacagtgcctag

KEGG   Ailuropoda melanoleuca (giant panda): 105241843
Entry
105241843         CDS       T01329                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0102 alpha chain
  KO
K06751  MHC class I antigen
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04144  Endocytosis
aml04145  Phagosome
aml04218  Cellular senescence
aml04514  Cell adhesion molecules
aml04612  Antigen processing and presentation
aml04940  Type I diabetes mellitus
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
aml05320  Autoimmune thyroid disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    105241843
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105241843
   04145 Phagosome
    105241843
  09143 Cell growth and death
   04218 Cellular senescence
    105241843
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105241843
   04612 Antigen processing and presentation
    105241843
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105241843
  09163 Immune disease
   05320 Autoimmune thyroid disease
    105241843
   05330 Allograft rejection
    105241843
   05332 Graft-versus-host disease
    105241843
  09166 Cardiovascular disease
   05416 Viral myocarditis
    105241843
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    105241843
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105241843
   05170 Human immunodeficiency virus 1 infection
    105241843
   05168 Herpes simplex virus 1 infection
    105241843
   05163 Human cytomegalovirus infection
    105241843
   05167 Kaposi sarcoma-associated herpesvirus infection
    105241843
   05169 Epstein-Barr virus infection
    105241843
   05165 Human papillomavirus infection
    105241843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    105241843
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
    105241843
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   105241843
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
 Antigens
  105241843
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 Ig_2 C2-set_2 ig
Other DBs
NCBI-GeneID: 105241843
NCBI-ProteinID: XP_034516098
LinkDB
Position
5
AA seq 457 aa
MESFGTRQKLSKLILEVLESHSVSLNNQTNVTKLVLYGFRTTAVCREDWLEKRNQSAFGC
FHSPRGDSAARRNRLLPATRPPTLLLLLLSRALALTDARAGEKPPQRGRREGAAGPKRCS
AAWRSPPPHSHLGPYSSPTHCPFSVARTSLAPCPLGRLHLRPGPRGGRRVGRGLSPCAPA
GLHSLRYLGTAVSRPGRGEPRYVEVGYVQDTQFVRFDSDAASPGMEPRAPRVEQEGPEDW
DPETRDSGTCTQTPEXKLNEVRRRYNQSEAGSHTFQRMIGXDGRLLRGNEQFAYDGAGYI
ALNHDLRSWTLNHDLRSWTSADTAAQIARRXWEAAGEAEHYGNYLDGACLDWXPQHLENA
KETLRRAEPPNTRMTXHRISDHDVTLRCWALGFYPAEITLTWQQDGEDLTQATEHVETRP
AGDGTSQKRAXGEEQRYTCHVQHEGLPEPLTLRRAAA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagagctttggaacaaggcagaaactttctaagttgattctggaagtactagagagt
cactctgtgtccttgaacaaccagaccaatgtaacaaagctagtactatatggttttagg
actacagctgtttgtagggaggactggctggagaagagaaaccaatcagcgttcgggtgt
tttcactcgcctcggggcgactcagctgctcgccggaacaggttgttgccagccactcgt
cctccaaccctcctcctgctgctgctgtcgcgggccctggccctgacagacgccagggcg
ggtgagaaaccgcctcagcgtgggaggagggagggggccgccggacccaagcgctgctcc
gctgcctggcgctcacctccgccccactcacacctgggtccctactcttctccgacccac
tgccccttttccgtcgcgcgaacctctctcgccccctgccctctcgggcgcctccacctg
cgccccgggccccgcggcgggaggagagtcgggcgaggtctcagcccctgcgcgcccgca
ggcttgcactccctgcggtatttgggcaccgccgtgtcccggcccggtcgcggggagccc
cggtacgtggaagtcggctacgtgcaggacacgcagttcgtgcggttcgacagcgacgca
gcgagtccggggatggagccgcgggcgccgcgggtggagcaggaggggccggaagattgg
gacccggagacgcgggactccgggacctgcacacagactccggagnggaagctgaacgaa
gtgcgccgccgctacaaccagagcgaggcagggtctcacaccttccagagaatgataggc
nntgatgggcgccttctccgcgggaatgagcagttcgcctacgacggcgcgggttacatc
gccctgaaccacgacctgcgctcctggaccctgaaccacgacctgcgctcctggacctcg
gcggacacggcggcgcagatcgcccggcgctagtgggaggcggcgggtgaggccgaacac
tacgggaactatctggacggcgcgtgcttggactggnctccgcagcacctggagaacgcg
aaggagacgctgcggcgcgcagaaccccccaacacacgtatgaccntgcaccgcatctct
gaccatgatgtcaccctgagatgctgggctctgggcttctaccctgcggagatcaccctg
acctggcagcaggatggggaggacctgacccaggccacagaacatgtggagaccaggcct
gcaggagatgggacctcccagaagcgggcgngcggagaggagcagagatacacgtgccac
gtgcagcatgaggggctgcctgagcccctcaccttgagacgggctgctgcctga

DBGET integrated database retrieval system