KEGG   Ailuropoda melanoleuca (giant panda): 100468235
Entry
100468235         CDS       T01329                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04068  FoxO signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04217  Necroptosis
aml04650  Natural killer cell mediated cytotoxicity
aml04722  Neurotrophin signaling pathway
aml04932  Non-alcoholic fatty liver disease
aml04940  Type I diabetes mellitus
aml05022  Pathways of neurodegeneration - multiple diseases
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05168  Herpes simplex virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05320  Autoimmune thyroid disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100468235 (FASLG)
   04014 Ras signaling pathway
    100468235 (FASLG)
   04068 FoxO signaling pathway
    100468235 (FASLG)
   04151 PI3K-Akt signaling pathway
    100468235 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100468235 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100468235 (FASLG)
   04217 Necroptosis
    100468235 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100468235 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100468235 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468235 (FASLG)
   05205 Proteoglycans in cancer
    100468235 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100468235 (FASLG)
   05330 Allograft rejection
    100468235 (FASLG)
   05332 Graft-versus-host disease
    100468235 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100468235 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100468235 (FASLG)
   04932 Non-alcoholic fatty liver disease
    100468235 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100468235 (FASLG)
   05161 Hepatitis B
    100468235 (FASLG)
   05160 Hepatitis C
    100468235 (FASLG)
   05164 Influenza A
    100468235 (FASLG)
   05162 Measles
    100468235 (FASLG)
   05168 Herpes simplex virus 1 infection
    100468235 (FASLG)
   05163 Human cytomegalovirus infection
    100468235 (FASLG)
   05165 Human papillomavirus infection
    100468235 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100468235 (FASLG)
   05143 African trypanosomiasis
    100468235 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100468235 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100468235 (FASLG)
   04052 Cytokines and growth factors [BR:aml04052]
    100468235 (FASLG)
   04090 CD molecules [BR:aml04090]
    100468235 (FASLG)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100468235 (FASLG)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Tumor necrosis fators
   100468235 (FASLG)
CD molecules [BR:aml04090]
 Proteins
  100468235 (FASLG)
SSDB
Motif
Pfam: TNF GutM
Other DBs
NCBI-GeneID: 100468235
NCBI-ProteinID: XP_002916992
Ensembl: ENSAMEG00000015538
UniProt: D2H5H5
LinkDB
Position
8
AA seq 277 aa
MQQPLNYPYPQIYWVDSSAGSPWAPPGSVLPCPSSVPGRPGPRRPPPPPPPTLPPPPPLA
PLPLPPVKTRRDHNTGVCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQSHIA
SSLEKQIGQPNPPSEKRELRKVAHLTGKSNSRSIPLEWEDTYGIALVSGVKYKKGGLVIN
DTGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKIMNYCTTGQMWARSSY
LGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccgtacccccaaatctactgggtggacagcagtgccggc
tctccctgggcccctcccggttcagtcctgccgtgtccgtcctctgtgccaggaaggcct
gggcccaggaggccaccgccgccaccgccaccaacactaccgccgccaccaccgctggct
ccgctgccgctgccgcctgtgaagacgcggagggaccacaacacaggcgtgtgcctcctt
gtgatgtttttcatggttctggtggccctggttggactggggctgggcatgttccagctc
ttccacctacagaaggagctggccgaactcagagagtccaccagccaaagtcatatagca
tcatctttggagaagcaaataggtcaacccaacccaccctctgaaaaaagggagctgaga
aaagtggcccatttaacaggcaagtccaactcaagatccatccctctggaatgggaagac
acatatggaattgcccttgtctctggggtgaagtataagaagggtggccttgtgatcaat
gatactgggttgtactttgtgtattccaaagtgtacttcaggggtcagtcctgcaacaac
cagcccctgaaccacaaggtctatatgaggaactctaagtatccccaggacctggtgctg
atggaggggaagataatgaactactgcactactggccagatgtgggcccgcagcagctac
ctgggagcggtattcaatctcaccagtgctgaccatttatatgtcaatgtatctgaactg
tctctggtcagttttgaggaatctaagacattttttggcttatataagctctaa

DBGET integrated database retrieval system