KEGG   Ailuropoda melanoleuca (giant panda): 100468867
Entry
100468867         CDS       T01329                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04014  Ras signaling pathway
aml04072  Phospholipase D signaling pathway
aml04360  Axon guidance
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04931  Insulin resistance
aml05168  Herpes simplex virus 1 infection
aml05205  Proteoglycans in cancer
aml05211  Renal cell carcinoma
aml05220  Chronic myeloid leukemia
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100468867 (PTPN11)
   04630 JAK-STAT signaling pathway
    100468867 (PTPN11)
   04072 Phospholipase D signaling pathway
    100468867 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100468867 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    100468867 (PTPN11)
   04670 Leukocyte transendothelial migration
    100468867 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100468867 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100468867 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    100468867 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100468867 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100468867 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100468867 (PTPN11)
   05211 Renal cell carcinoma
    100468867 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100468867 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100468867 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100468867 (PTPN11)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100468867 (PTPN11)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100468867 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 100468867
NCBI-ProteinID: XP_034495567
Ensembl: ENSAMEG00000008525
LinkDB
Position
12
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDSKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLTDQTSGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaacatcactggcgtggaggcagaaaacctgctg
ttgacaagaggagttgatggcagttttttggcaaggcccagtaaaagtaaccctggagac
ttcaccctttccgtcagaagaaatggcgctgtcacccacatcaagattcagaacactggt
gattactatgacttgtacggaggggagaagtttgccactttggctgagttggtccagtat
tatatggaacatcatgggcaattaaaagagaagaatggagatgttattgagcttaaatac
cctctgaactgtgcagaccctacctctgaaaggtggtttcatggacacctctctgggaag
gaagcagagaaattactaactgagaaaggaaaacatggtagctttctggtacgagagagc
cagagccatcccggagattttgttctctctgtccgaactggtgatgacaaaggggagagc
aacgacagcaagtctaaagtgacccacgtcatgatccgctgtcaggaactgaaatatgat
gttggtggaggagaacggtttgactctttgacggaccttgtggagcattacaagaagaat
cccatggtggaaacactgggcacagtactgcaactcaagcagcccctcaacacaacacgt
atcaatgctgctgaaatagaaagtcgggttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctacagccgaaaagagggtcagaggcaagaaaataagaacaaaaatagatataaa
aacatcctgccctttgatcataccagggttgtcctacacgatggtgatcccaatgagcct
gtttcagattacatcaatgcaaatattatcatgcctgagtttgaaaccaaatgcaacaat
tcaaagcccaaaaagagttacattgccacacaaggctgtctgcaaaacacggtgaatgac
ttttggcggatggtatttcaagagaactcccgagtgattgtcatgacaacgaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgacgagtatgctctgaaagaatat
ggggtcatgcgtgttaggaacgtcaaagaaagtgccgctcatgactatacattaagagaa
cttaaactttcaaaggttggacaagctctactccaggggaatacagagagaaccgtgtgg
cagtaccactttcggacctggccggaccacggagtgcccagtgaccctgggggtgtgctg
gacttcctggaggaggtccaccataagcaagagagcattatggacgcagggcccgtggta
gttcactgcagtgctggaatcggccggacagggacgttcattgtgattgatatccttatt
gacatcatcagagagaaaggtgtcgactgcgacattgatgttcccaaaaccattcagatg
gtgcggtctcagaggtcagggatggtccagacagaagcacagtaccgattcatctatatg
gccgtccagcattacattgaaacactacagcgcaggattgaagaagagcagaaaagcaag
aggaaagggcatgaatatacaaatattaagtattctctaacggaccagacaagtggagat
cagagtcccctcccgccttgtaccccaacaccatcttgtgcagaaatgagagaagataat
gctagagtctatgaaaacgtgggtctgatgcagcagcagaaaagtttcagatga

KEGG   Ailuropoda melanoleuca (giant panda): 100471152
Entry
100471152         CDS       T01329                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04014  Ras signaling pathway
aml04072  Phospholipase D signaling pathway
aml04360  Axon guidance
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04931  Insulin resistance
aml05168  Herpes simplex virus 1 infection
aml05205  Proteoglycans in cancer
aml05211  Renal cell carcinoma
aml05220  Chronic myeloid leukemia
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100471152
   04630 JAK-STAT signaling pathway
    100471152
   04072 Phospholipase D signaling pathway
    100471152
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100471152
   04650 Natural killer cell mediated cytotoxicity
    100471152
   04670 Leukocyte transendothelial migration
    100471152
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100471152
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100471152
  09158 Development and regeneration
   04360 Axon guidance
    100471152
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100471152
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100471152
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100471152
   05211 Renal cell carcinoma
    100471152
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100471152
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100471152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100471152
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100471152
Protein phosphatases and associated proteins [BR:aml01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100471152
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 100471152
NCBI-ProteinID: XP_034527913
Ensembl: ENSAMEG00000016617
LinkDB
Position
11
AA seq 516 aa
MTSRRWFHTNISGAEAGKLPLSGGRHGGFLARPSKSCPGGFTLSVRRRDEVAHIKIQNTG
DYYNLSGGEKFAALAELVQHYTGQRGGLLRERSGAPVELQHPLGCQDPTAERWYHEHLSG
KEAEQLLMEKGRPGTFLVRESQSKPGDFVLSAHTXQPDKADHRPRVTHVMIHFQPDGKYD
VGGGEQFDTLADLVECYKRNPMVERSGTVLHLKQPLKATRISAASIESRVQELNRATDAG
EKAKQGFWEEFEMLQQQECRLLYPRKEGQRLENKPKNRYKNILPFDTTRVILHDVDDSVP
GANCINANYVRSDPEEKPGHGWGKVYIATQGCLQTTAAAFWAMVHQEDTRVIVMATREVE
RGQNKCFRYWPELHGCQEYGHVRICNLAEYQAQGYCVRELQVWRPDQEEPPRTAKHYQYF
GWPDHGVPAEPSGVLGFLDEVNRAQSSMPGAGPMVVHCSAGIGRTGTLIVIDILVDLLRR
QGEPPCRPRPSRLASPAPRTAEAPGGEYENLRGIAR
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgacctcgcgcaggtggtttcacaccaacatcagcggagctgaggctgggaagctgccc
ctgtccgggggccggcatgggggcttcctggcgagacccagcaagagctgcccagggggc
ttcacactgtccgtcagacgccgggatgaggtggcccacatcaagatccagaacaccggc
gactactacaatctctccgggggggagaagttcgcagcgctggccgagctggtgcagcac
tacacaggccagcgcgggggactgctccgtgagcgcagcggggcccccgttgagctccag
cacccactgggctgccaggaccccacagctgagcggtggtaccatgagcacctgtctggc
aaggaggccgagcagctgctgatggaaaaaggacgtccgggtaccttcctggtgcgggag
agtcagagcaaacctggggactttgtgctgtctgctcacacanngcagccagacaaggca
gaccaccggccacgggtcacacacgtcatgatccacttccagccagatgggaagtatgat
gtgggaggtggggaacagttcgacaccctcgcagacctggtggaatgctacaaaaggaac
cccatggtggagaggtcggggactgtgctgcatctcaagcagcccctcaaggccacaagg
atcagtgccgcaagcatcgagagccgagtacaagagctcaacagggccactgatgccggc
gaaaaagccaagcagggcttctgggaagaattcgagatgctgcagcagcaggaatgtcgg
ctcctgtacccacggaaggagggacagcggttggagaacaagcccaagaatcgctacaag
aacatccttccctttgataccacccgtgtcattctgcatgatgtggatgacagcgtgccc
ggagccaactgcatcaacgcgaactacgtcaggagtgatccagaggagaagccaggtcat
ggatggggcaaggtgtacatcgccacccagggctgtctgcaaaccacagcagctgccttc
tgggcaatggtgcaccaggaggacacacgagtcattgtcatggccacaagggaggtggag
cgaggccagaacaaatgtttccggtattggccagagctgcatggctgccaagaatatggc
cacgtccgtatttgcaacttggctgagtaccaggctcagggttactgtgtgcgggaactg
caggtgtggcggccagatcaggaggagccaccgcgtacagcgaagcactaccagtacttc
ggctggccagaccacggggtcccggccgagccctccggcgtcctcggctttctggacgag
gtgaacagggcccagagcagcatgccgggggccggccccatggtggtgcactgcagcgcc
ggcatcggacgcactggcaccctcatcgtgattgacatcctggtagacctcctccgcagg
caaggtgagcctccctgccgaccccgcccctcccgtctagcctccccggccccccggacc
gcggaggcccccggcggcgagtatgagaacctgcggggcatcgcgcggtga

DBGET integrated database retrieval system