KEGG   Ailuropoda melanoleuca (giant panda): 100473450
Entry
100473450         CDS       T01329                                 

Gene name
LDLR
Definition
(RefSeq) low-density lipoprotein receptor isoform X2
  KO
K12473  low-density lipoprotein receptor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04144  Endocytosis
aml04913  Ovarian steroidogenesis
aml04925  Aldosterone synthesis and secretion
aml04927  Cortisol synthesis and secretion
aml04934  Cushing syndrome
aml04976  Bile secretion
aml04979  Cholesterol metabolism
aml05145  Toxoplasmosis
aml05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100473450 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100473450 (LDLR)
   04925 Aldosterone synthesis and secretion
    100473450 (LDLR)
   04927 Cortisol synthesis and secretion
    100473450 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    100473450 (LDLR)
   04979 Cholesterol metabolism
    100473450 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100473450 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100473450 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100473450 (LDLR)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100473450 (LDLR)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF SGL EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 100473450
NCBI-ProteinID: XP_002921438
Ensembl: ENSAMEG00000010827
LinkDB
Position
4
AA seq 857 aa
MRPAGWGLCWAIALLLAATGAAVEDTCGRNEFQCQDGKCISYKWVCDGSAECLDASDESQ
ETCMSVTCKSGDFSCGGRVNRCIPQPWRCDGQVDCENGSDEQGCLPRTCAQNEFRCQDGK
CIALDFVCDSDRDCLDGSDEASCPMPTCGPASFQCNNSACIPDLWACDGDPDCKDGSDEW
PQRCGGRNTSAPQRDNGPCSSLEFYCRSGECIHSSWRCDGGPDCKDKSDEENCTVATCRP
DEFQCSDGTCIHGSRQCNRENDCKDMSDELGCINVTLCEGPNKFKCHSGECITLDKVCNS
IRDCRDWSDEPLKECGTNECLDNKGGCSHICNDLKMGYECLCPKGFRLVDQRRCEDIDEC
QDPDVCSQLCVNLEGSYKCDCEEGFQLDPHTKACKAVGNIAYLFFTNRHEVRKMTLDRSE
YTSLIPNLKNVVALDMEVARNRIYWSDLSQRKIYSTHIDRATSFSSYDTVISEDLQAPDG
LAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFKEKGSKPRAIVVDPVHGFMYWTDWGT
PAKIKKGGLNGVDVYSLVTEDIQWPNGITLDLSGGRLYWVDSKLHSISSIDVNGGNRKIV
LEDKKKLAHPFSLAIFEDKIFWTDIINEAIFSANRLTGSDINLVAENLLSPEDIVLFHNL
TQPRGVNWCERTALRNGGCQYLCLPAPQINPHSPKFTCACPDGMLLAKDMRSCLIGAEPG
TTTRGTSTVTVRPTVRSTAVEPKHTASPWSVASPEFTTAETVTMSQHALGDAASRGDEEK
PRSVGALYIILPIVLLILLCFGTFLLWKNWRLKSVNSINFDNPVYQKTTEDEVHICYSQD
GYTYPSRQMVSLEDDVA
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgagacccgcgggctgggggctgtgctgggccatcgccctgctcctcgcagcgactggg
gcggcagtggaagacacgtgtgggagaaacgagttccagtgccaagatgggaagtgcatc
tcctacaagtgggtttgtgacgggagcgccgagtgcctggatgcctccgatgagtcccag
gagacctgcatgtctgtcacctgcaagtctggggacttcagctgtggcggccgtgtcaac
cgctgcatccctcagccctggcgatgtgacggccaggtggactgcgagaacggctccgac
gagcaaggctgtctgcccagaacgtgcgcccagaatgagttccgctgccaggatgggaag
tgcatcgccctggatttcgtctgtgattcggatcgggactgtttggacgggtccgacgag
gcgtcctgccccatgcccacctgcggccctgccagcttccagtgcaacaactctgcctgc
atccccgatctgtgggcttgtgacggcgaccccgactgcaaggatggctcagatgagtgg
ccgcagcgctgtgggggccgcaacacgtcagccccccaacgggacaatggcccttgctcg
tccctcgaattctactgccggagcggcgaatgcatccactccagctggcgctgtgacggc
ggccctgactgcaaggacaagtccgatgaggagaactgcactgtggccacgtgccggcct
gatgagttccagtgctcggacgggacctgtatccacggcagccggcagtgcaacagggag
aatgactgtaaggacatgagcgacgagctcggctgcatcaacgtgacgctgtgtgagggc
cccaacaagttcaagtgccacagcggcgaatgcatcacactggacaaagtgtgcaactcg
atcagggactgtcgggactggtcggacgagcccctcaaggagtgcgggaccaacgagtgt
ctggacaacaagggcggctgctcccacatctgcaacgacctcaagatgggctatgagtgt
ttgtgccctaagggcttccggctggtggaccagcgaagatgcgaagatattgacgagtgt
caggatcccgacgtgtgcagccagctgtgcgtgaatctcgagggcagctacaagtgcgac
tgtgaggagggcttccagctggacccccacaccaaggcctgcaaggctgtgggcaacatc
gcctacctctttttcaccaaccgccacgaggtgcggaagatgaccctggaccgcagtgaa
tacaccagcctcatcccgaacctgaagaacgtcgtggccctagacatggaggtggcccgc
aacagaatctactggtctgacctgtcccagaggaagatctacagtacccatatcgacaga
gccaccagcttctcctcctatgacactgtcatcagcgaggacctccaggcccccgacggg
ctggcagtggactggatccacagcaacatatactggacagactccgtcctgggcactgtc
tccgtggcggacaccaagggtgtgaagagaaagacgctcttcaaggagaaaggctccaag
ccgcgtgccatcgtggtggaccccgtgcatggcttcatgtactggacagattggggaacc
cctgccaagatcaagaaggggggtctgaatggtgttgacgtttactcgcttgtcacggaa
gacatccagtggcccaatggcatcaccctggatctttctggtggccgcctctactgggtt
gactccaagctccactccatctccagcattgacgtcaacggcgggaaccggaagatcgtt
ttggaggacaagaaaaagctggcgcaccccttctccttggccatcttcgaggataaaata
ttttggacagacatcatcaacgaagccattttcagtgccaaccgtctcacaggctcagac
attaatttggtggcagaaaacctgttgtctccagaggacattgtcctttttcacaacctc
acacagccaagaggggtgaactggtgtgagaggaccgccctccgcaatggtggctgccag
tacctgtgtctcccagccccgcagatcaacccccactcgcccaagttcacctgtgcctgc
cctgatggcatgctgctggccaaggacatgaggagctgcctcataggggcggaacctgga
acgaccacccggggtacctccacggtcacagtcaggccgacagtccgctccacggccgtg
gagccaaagcacacagccagcccgtggtccgtggccagccctgagttcaccacggcagag
acggtgacgatgtcccaacacgccctgggagatgccgccagcagaggagatgaggagaag
ccaaggagcgtgggggctctgtacatcatcctccccattgtcctgctcatcctgctgtgt
ttcgggaccttcctcctctggaagaactggcggctcaagagcgtcaacagcatcaacttt
gacaaccccgtgtaccagaagaccacggaggatgaggtccacatctgctacagccaggac
ggctacacctacccttcgagacagatggtcagcctggaggatgatgtggcgtga

DBGET integrated database retrieval system