KEGG   Ailuropoda melanoleuca (giant panda): 100473486
Entry
100473486         CDS       T01329                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04072  Phospholipase D signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04630  JAK-STAT signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05231  Choline metabolism in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100473486 (PDGFA)
   04014 Ras signaling pathway
    100473486 (PDGFA)
   04015 Rap1 signaling pathway
    100473486 (PDGFA)
   04630 JAK-STAT signaling pathway
    100473486 (PDGFA)
   04020 Calcium signaling pathway
    100473486 (PDGFA)
   04072 Phospholipase D signaling pathway
    100473486 (PDGFA)
   04151 PI3K-Akt signaling pathway
    100473486 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100473486 (PDGFA)
   04540 Gap junction
    100473486 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100473486 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473486 (PDGFA)
   05202 Transcriptional misregulation in cancer
    100473486 (PDGFA)
   05206 MicroRNAs in cancer
    100473486 (PDGFA)
   05231 Choline metabolism in cancer
    100473486 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    100473486 (PDGFA)
   05218 Melanoma
    100473486 (PDGFA)
   05215 Prostate cancer
    100473486 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100473486 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100473486 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100473486 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100473486 (PDGFA)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100473486 (PDGFA)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100473486 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100473486
NCBI-ProteinID: XP_034525513
LinkDB
Position
10
AA seq 257 aa
MRTWACLLLLGCGYLAHALAEEAEIPREVIERLARSQIYSIRDLQRLLEIDSVGAEDALE
ASLRAHGGHASKHAPEKRPMPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCAGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECTCT
ASGLNPDHREEETAISRELCVNQSSPSRACRSPSSPQRGGPVPVFGQNLNSLFLVRCYAL
RVFNRNVCVCCVFVFVL
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctactcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagatcccccgcgaggtgattgagaggctggcgcgcagtcagatctacagc
atccgggacctccagcgactcctggagatagactccgtaggggccgaggatgctttggaa
gcgagtctgagagcccacgggggccatgccagcaagcatgcacccgagaagaggcccatg
cccatccggaggaaaagaagcatcgaggaagccatccccgcggtctgcaagaccaggacg
gtcatttatgagatacctcggagccaggtcgaccccacatctgccaacttcctgatctgg
cccccgtgcgtggaggtgaagcgctgtgccgggtgctgtaacaccagcagcgtcaagtgt
cagccttcccgcgtccaccaccgcagcgtcaaggtggccaaggtggagtacgtcaggaag
aagccaaagttgaaagaagtgcaggtgcgcctggaggagcatctggaatgcacgtgcacg
gccagcgggctgaacccggaccaccgggaggaggagacggccatttcgagagaactatgc
gtgaaccaatcgagtccgtcccgggcctgccgctccccgtcctcgccgcagcgaggtggc
cctgtgccagtatttggacagaatctaaattctttatttttggtaagatgttacgcttta
cgtgtattcaacagaaatgtgtgtgtgtgttgtgtttttgtttttgttttgtaa

KEGG   Ailuropoda melanoleuca (giant panda): 100475543
Entry
100475543         CDS       T01329                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X4
  KO
K17386  platelet-derived growth factor subunit B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04072  Phospholipase D signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04630  JAK-STAT signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05231  Choline metabolism in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100475543 (PDGFB)
   04014 Ras signaling pathway
    100475543 (PDGFB)
   04015 Rap1 signaling pathway
    100475543 (PDGFB)
   04630 JAK-STAT signaling pathway
    100475543 (PDGFB)
   04020 Calcium signaling pathway
    100475543 (PDGFB)
   04072 Phospholipase D signaling pathway
    100475543 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100475543 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100475543 (PDGFB)
   04540 Gap junction
    100475543 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100475543 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475543 (PDGFB)
   05206 MicroRNAs in cancer
    100475543 (PDGFB)
   05231 Choline metabolism in cancer
    100475543 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100475543 (PDGFB)
   05218 Melanoma
    100475543 (PDGFB)
   05211 Renal cell carcinoma
    100475543 (PDGFB)
   05215 Prostate cancer
    100475543 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100475543 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100475543 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100475543 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100475543 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100475543 (PDGFB)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100475543 (PDGFB)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100475543 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100475543
NCBI-ProteinID: XP_011217152
Ensembl: ENSAMEG00000010844
LinkDB
Position
15
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGASVEEDGAEL
DLNLTLSHSGGELESLTRGRRSPGSPTVAEPAVIAECKTRTEVFEISRRLIDHTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKC
ETVVAARPVTRSLGSTQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKKALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctctacgagatgctgagtgaccactcgatccgctcc
tttgatgacctccagcgtctgctgcatggagcctccgtagaggaagacggggccgagctg
gacctgaatttgaccctatcccattctggaggcgagctggagagcttaacccgagggaga
aggagcccaggttccccgacggtcgccgagccggccgtgatcgccgagtgcaagacgcgc
actgaggtgttcgagatctcgcggcgcctcatagaccacaccaacgctaacttcctggtg
tggccaccgtgcgtggaggtgcagcgctgctcgggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcggcccgtccaggtgagaaaaatcgagattgtacgg
aagaagccaacctttaagaaggccacggtgaccctggaggaccacctggcgtgcaagtgt
gagacagtggtggctgctcgacctgtgacccgaagcctggggagtacccaagagcagcga
gccaagacaccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
gggaagcaccggaagttcaagcacacgcatgacaagaaggcgctgaaggagaccctcgga
gcctag

DBGET integrated database retrieval system