KEGG   Ailuropoda melanoleuca (giant panda): 100474551
Entry
100474551         CDS       T01329                                 

Gene name
NR1H3
Definition
(RefSeq) oxysterols receptor LXR-alpha isoform X1
  KO
K08536  liver X receptor alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03320  PPAR signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100474551 (NR1H3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100474551 (NR1H3)
   04931 Insulin resistance
    100474551 (NR1H3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100474551 (NR1H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100474551 (NR1H3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aml03310]
    100474551 (NR1H3)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100474551 (NR1H3)
Nuclear receptors [BR:aml03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   100474551 (NR1H3)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100474551
NCBI-ProteinID: XP_011226264
Ensembl: ENSAMEG00000007298
UniProt: G1LL75
LinkDB
Position
16
AA seq 447 aa
MSLWLEAPVPDASPDSAVQLWEPDTQDAGSQALGGNACIFREEASTLQSVGGSLGAGPEA
AEPTVLLPAVDPPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAQATSVTPRVSSPPQVLPQLSPEQWGMIEKLVAAQQQCNRRSFSDRLRVTPWPV
APDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVEKLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtccttgtggctggaggcacctgtgcctgatgcttctcctgactctgcagtgcagctg
tgggagccagatacgcaagatgccggcagccaggcactgggaggcaacgcgtgcatcttc
agggaggaagccagcactctccaatctgtggggggctctctgggggcagggccagaggca
gcagagcccacagtcctgctccctgcggtggatccccctccggagtctacagagctccgt
ccacaaaagcggaaaaaggggccagcccccaaaatgctggggaacgagctgtgcagtgtg
tgtggagacaaggcctccgggttccactacaacgtgctgagctgtgagggctgcaaggga
ttcttccgccgcagtgtcatcaaaggggcgcgctatgtctgccacagtgggggccactgc
cccatggacacctacatgcgtcgcaagtgccaggagtgtcgtcttcgaaaatgccgccag
gccggcatgcgggaggagtgtgtcttgtcagaagagcagatccgcctgaagaaactgaag
cggcaagaggaggaacaggctcaggccacgtccgtgacccccagggtgtcctcacctccc
caagtcctgccccagctcagccctgagcagtggggcatgattgagaagctggtggctgcc
cagcagcagtgtaacagacgctcgttctctgaccggcttcgggtcacgccttggcccgtg
gccccagatccccagagccgggaggcccgtcagcagcgctttgcccacttcaccgagctc
gccatcgtctccgtgcaggagatcgttgattttgccaaacagctgcctggcttcctgcag
ctcagccgggaggaccagatcgccctgctgaagacctctgcgatcgaggtgatgcttctg
gagacatctcggaggtacaaccctggcagtgagagtatcaccttcctcaaggatttcagt
tataaccgggaagactttgccaaagcggggttgcaggtggagttcatcaaccccatcttc
gagttctccagagccatgaatgagctgcagcttaacgacgccgagtttgctttgctcatt
gccatcagcatcttctctgcagaccggcccaacgtgcaggaccagctccaggtagagaag
ctgcaacacacatatgtggaggccctgcatgcctacgtctccatccaccacccccatgac
cgactgatgttcccacggatgctaatgaaactggtgagcctccggacactgagtagtgtc
cattcagagcaagtgtttgcactgcgcctgcaggacaaaaaacttcccccgctgctctct
gagatctgggatgtgcacgaatga

DBGET integrated database retrieval system